# medplum.com > AI-optimized mirror of medplum.com containing 2804 pages totalling 876,848 words of clean markdown content, structured data, and semantic HTML. Original source: https://medplum.com. Last updated: 2026-08-11T13:23:09.170Z. Each page is available as HTML (with JSON-LD structured data) and Markdown (text-only, ideal for LLMs and RAG). ## Homepage - [Get Your Free T-Shirt!](/content/thanks/index.html) (65 words) - [Medplum Status](/content/status/index.html): Medplum status and uptime statistics (16 words) - [medplum #faq](/content/linen/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #faq Latest (1,988 words) - [Trust Center - Medplum](/content/trust/index.html): Medplum is the open source healthcare developer platform that helps you build, test, and deliver any healthcare product or service. (223 words) - [Medplum APT Repository](/content/apt/index.html): Medplum APT Repository (44 words) - [Medplum / Introduction - Docs ⋅ Storybook](/content/storybook/index.html) (196 words) - [Medplum GraphiQL](/content/graphiql/index.html) (26 words) - [Medplum](/content/viewer/index.html): Medplum: Medical Collaboration (31 words) - [Medplum](/content/site-root.html) (871 words) ## Articles & Blog Posts - [assets/files/sample-diagnostic-catalog-f44be3fcb85b438bf4e659c84f1217f7-json.html](/content/assets/files/sample-diagnostic-catalog-f44be3fcb85b438bf4e659c84f1217f7-json.html) (1,461 words) - [Observation | Medplum](/content/docs/api/fhir/resources/observation/index.html): Measurements and simple assertions made about a patient, device or other subject. US Core Profiles related to Observations are as follows: (1,191 words) - [decision-guides/intake-pdf.html](/content/decision-guides/intake-pdf.html) (2,623 words) - [NutritionOrder | Medplum](/content/docs/api/fhir/resources/nutritionorder/index.html): A request to supply a diet, formula feeding (enteral) or oral nutritional supplement to a patient/resident. (4,251 words) - [decision-guides/e-prescribe-pdf.html](/content/decision-guides/e-prescribe-pdf.html) (2,643 words) - [RequestGroup | Medplum](/content/docs/api/fhir/resources/requestgroup/index.html): A group of related requests that can be used to capture intended activities that have inter-dependencies such as "give this medication after that one". (2,545 words) - [Advanced Search Parameters | Medplum](/content/docs/search/advanced-search-parameters/index.html): The FHIR search framework allows for special search parameters that enable more complex searches to fine-tune your results. In this document, we will go over the following special parameters: (1,655 words) - [decision-guides/e-prescribe-docx.html](/content/decision-guides/e-prescribe-docx.html) (2,658 words) - [Patient | Medplum](/content/docs/api/fhir/resources/patient/index.html): Demographics and other administrative information about an individual or animal receiving care or other health-related services. Refer to the following profiles for information on representing specific details: (2,963 words) - [ResearchDefinition | Medplum](/content/docs/api/fhir/resources/researchdefinition/index.html): The ResearchDefinition resource describes the conditional state (population and any exposures being compared within the population) and outcome (if specified) that the knowledge (evidence, assertion, recommendation) is about. (2,909 words) - [decision-guides/referrals-pdf.html](/content/decision-guides/referrals-pdf.html) (2,480 words) - [medplum #faq](/content/linen/c/faq/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #faq Latest (1,884 words) - [Procedure | Medplum](/content/docs/api/fhir/resources/procedure/index.html): An action that is or was performed on or for a patient. This can be a physical intervention like an operation, or less invasive like long term services, counseling, or hypnotherapy. Refer to the US Core Procedure profile. (1,742 words) - [Provenance | Medplum](/content/docs/api/fhir/resources/provenance/index.html): Provenance of a resource is a record that describes entities and processes involved in producing and delivering or otherwise influencing that resource. Provenance provides a critical foundation for assessing authenticity, enabling trust, and allowing reproducibility. Provenance assertions are a form of contextual metadata and can themselves become important records with their own provenance. Provenance statement indicates clinical significance in terms of confidence in authenticity, reliability, and trustworthiness, integrity, and stage in lifecycle (e.g. Document Completion - has the artifact been legally authenticated), all of which may impact security, privacy, and trust policies. (2,139 words) - [NamingSystem | Medplum](/content/docs/api/fhir/resources/namingsystem/index.html): A curated namespace that issues unique symbols within that namespace for the identification of concepts, people, devices, etc. Represents a "System" used within the Identifier and Coding data types. (2,392 words) - [QuestionnaireResponse | Medplum](/content/docs/api/fhir/resources/questionnaireresponse/index.html): A structured set of questions and their answers. The questions are ordered and grouped into coherent subsets, corresponding to the structure of the grouping of the questionnaire being responded to. Read related on US Core QuestionnaireResponse profile. (2,518 words) - [Practitioner | Medplum](/content/docs/api/fhir/resources/practitioner/index.html): A person who is directly or indirectly involved in the provisioning of healthcare. (1,978 words) - [medplum #releases](/content/linen/c/releases/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #releases Latest (883 words) - [Medplum GitHub Star T-Shirt Giveaway: Terms and Conditions](/content/thanks/terms-html.html) (637 words) - [ResearchElementDefinition | Medplum](/content/docs/api/fhir/resources/researchelementdefinition/index.html): The ResearchElementDefinition resource describes a "PICO" element that knowledge (evidence, assertion, recommendation) is about. (2,375 words) - [decision-guides/rcm-billing-docx.html](/content/decision-guides/rcm-billing-docx.html) (3,121 words) - [PaymentReconciliation | Medplum](/content/docs/api/fhir/resources/paymentreconciliation/index.html): This resource provides the details including amount of a payment and allocates the payment items being paid. (1,652 words) - [RelatedPerson | Medplum](/content/docs/api/fhir/resources/relatedperson/index.html): Information about a person that is involved in the care for a patient, but who is not the target of healthcare, nor has a formal responsibility in the care process. (1,916 words) - [decision-guides/access-control-pdf.html](/content/decision-guides/access-control-pdf.html) (1,363 words) - [RiskAssessment | Medplum](/content/docs/api/fhir/resources/riskassessment/index.html): An assessment of the likely outcome(s) for a patient or other subject as well as the likelihood of each outcome. (1,711 words) - [PaymentNotice | Medplum](/content/docs/api/fhir/resources/paymentnotice/index.html): This resource provides the status of the payment for goods and services rendered, and the request and response resource references. (1,496 words) - [Organization | Medplum](/content/docs/api/fhir/resources/organization/index.html): A formally or informally recognized grouping of people or organizations formed for the purpose of achieving some form of collective action. Includes companies, institutions, corporations, departments, community groups, healthcare practice groups, payer/insurer, etc. (1,968 words) - [decision-guides/access-control-docx.html](/content/decision-guides/access-control-docx.html) (1,291 words) - [decision-guides/charting-docx.html](/content/decision-guides/charting-docx.html) (1,046 words) - [apt/apt-medplum-com-asc.html](/content/apt/apt-medplum-com-asc.html) (59 words) - [decision-guides/charting-pdf.html](/content/decision-guides/charting-pdf.html) (1,012 words) - [Person | Medplum](/content/docs/api/fhir/resources/person/index.html): Demographics and administrative information about a person independent of a specific health-related context. (874 words) - [PractitionerRole | Medplum](/content/docs/api/fhir/resources/practitionerrole/index.html): A specific set of Roles/Locations/specialties/services that a practitioner may perform at an organization for a period of time. (1,183 words) - [medplum #general](/content/linen/c/general/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #general Latest (9,766 words) - [medplum #dev](/content/linen/c/dev/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #dev Latest (29,848 words) - [assets/files/soap-note-bundle-12968a2406b46eac41e82a82482910ba-json.html](/content/assets/files/soap-note-bundle-12968a2406b46eac41e82a82482910ba-json.html) (503 words) - [ResearchSubject | Medplum](/content/docs/api/fhir/resources/researchsubject/index.html): A physical entity which is the primary unit of operational and/or administrative interest in a study. (1,205 words) - [InsurancePlan | Medplum](/content/docs/api/fhir/resources/insuranceplan/index.html): Details of a Health Insurance product/plan provided by an organization. (4,499 words) - [Parameters | Medplum](/content/docs/api/fhir/resources/parameters/index.html): This resource is a non-persisted resource used to pass information into and back from an operation. It has no other use, and there is no RESTful endpoint associated with it. (548 words) - [OrganizationAffiliation | Medplum](/content/docs/api/fhir/resources/organizationaffiliation/index.html): Defines an affiliation/assotiation/relationship between 2 distinct oganizations, that is not a part-of relationship/sub-division relationship. (1,001 words) - [medplum #intros](/content/linen/c/intros/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #intros Latest (9,672 words) - [PlanDefinition | Medplum](/content/docs/api/fhir/resources/plandefinition/index.html): This resource allows for the definition of various types of plans as a sharable, consumable, and executable artifact. The resource is general enough to support the description of a broad range of clinical artifacts such as clinical decision support rules, order sets and protocols. (546 words) - [medplum #hackathon-2026](/content/linen/c/hackathon-2026/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #hackathon-2026 Latest (7,721 words) - [medplum #plumcon-2026](/content/linen/c/plumcon-2026/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #plumcon-2026 Latest (59 words) - [core.agentheartbeatrequest.type | Medplum](/content/docs/sdk/core-agentheartbeatrequest-type.html): Home > @medplum/core > AgentHeartbeatRequest > type (7 words) - [core.agentheartbeatrequest | Medplum](/content/docs/sdk/core-agentheartbeatrequest.html): Home > @medplum/core > AgentHeartbeatRequest (20 words) - [core.agentheartbeatresponse | Medplum](/content/docs/sdk/core-agentheartbeatresponse.html): Home > @medplum/core > AgentHeartbeatResponse (19 words) - [core.agenterror | Medplum](/content/docs/sdk/core-agenterror.html): Home > @medplum/core > AgentError (22 words) - [core.agenterror.type | Medplum](/content/docs/sdk/core-agenterror-type.html): Home > @medplum/core > AgentError > type (13 words) - [core.agenterror.body | Medplum](/content/docs/sdk/core-agenterror-body.html): Home > @medplum/core > AgentError > body (7 words) - [core.agentconnectrequest.type | Medplum](/content/docs/sdk/core-agentconnectrequest-type.html): Home > @medplum/core > AgentConnectRequest > type (7 words) - [Trust Center - Medplum](/content/trust/resources/index.html): Medplum is the open source healthcare developer platform that helps you build, test, and deliver any healthcare product or service. (414 words) - [core.agentconnectresponse.type | Medplum](/content/docs/sdk/core-agentconnectresponse-type.html): Home > @medplum/core > AgentConnectResponse > type (7 words) - [Trust Center - Medplum](/content/trust/controls/index.html): Medplum is the open source healthcare developer platform that helps you build, test, and deliver any healthcare product or service. (902 words) - [OperationDefinition | Medplum](/content/docs/api/fhir/resources/operationdefinition/index.html): A formal computable definition of an operation (on the RESTful interface) or a named query (using the search interaction). (605 words) - [core.isorganizationarray | Medplum](/content/docs/sdk/core-isorganizationarray.html): Home > @medplum/core > isOrganizationArray (48 words) - [ObservationDefinition | Medplum](/content/docs/api/fhir/resources/observationdefinition/index.html): Set of definitional characteristics for a kind of observation or measurement produced or consumed by an orderable health care service. (321 words) - [Trust Center - Medplum](/content/trust/subprocessors/index.html): Medplum is the open source healthcare developer platform that helps you build, test, and deliver any healthcare product or service. (198 words) - [MolecularSequence | Medplum](/content/docs/api/fhir/resources/molecularsequence/index.html): Raw data describing a biological sequence. (3,404 words) - [medplum #support](/content/linen/c/support/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #support Latest (7,560 words) - [OperationOutcome | Medplum](/content/docs/api/fhir/resources/operationoutcome/index.html): A collection of error, warning, or information messages that result from a system action. (357 words) - [core.splitsearchoncomma | Medplum](/content/docs/sdk/core-splitsearchoncomma.html): Home > @medplum/core > splitSearchOnComma (44 words) - [HealthcareService | Medplum](/content/docs/api/fhir/resources/healthcareservice/index.html): The details of a healthcare service available at a location. (3,400 words) - [Questionnaire | Medplum](/content/docs/api/fhir/resources/questionnaire/index.html): A structured set of questions intended to guide the collection of answers from end-users. Questionnaires provide detailed control over order, presentation, phraseology and grouping to allow coherent, consistent data collection. (4,067 words) - [MedicationRequest | Medplum](/content/docs/api/fhir/resources/medicationrequest/index.html): An order or request for both supply of the medication and the instructions for administration of the medication to a patient. The resource is called "MedicationRequest" rather than "MedicationPrescription" or "MedicationOrder" to generalize the use across inpatient and outpatient settings, including care plans, etc., and to harmonize with workflow patterns. Refer to the US Core Medication Request profile. (4,011 words) - [core.logger.options | Medplum](/content/docs/sdk/core-logger-options.html): Home > @medplum/core > Logger > options (8 words) - [apt/setup-sh.html](/content/apt/setup-sh.html) (187 words) - [Trust Center - Medplum](/content/trust/faq/index.html): Medplum is the open source healthcare developer platform that helps you build, test, and deliver any healthcare product or service. (34 words) - [CarePlan | Medplum](/content/docs/api/fhir/resources/careplan/index.html): Describes the intention of how one or more practitioners intend to deliver care for a particular patient, group or community for a period of time, possibly limited to care for a specific condition or set of conditions. Refer to the US Core CarePlan profile. (3,330 words) - [Medplum](/content/app/admin/config/index.html): Medplum: Medical Collaboration (23 words) - [core.valueorexternalsecret | Medplum](/content/docs/sdk/core-valueorexternalsecret.html): Home > @medplum/core > ValueOrExternalSecret (23 words) - [Medplum](/content/app/admin/super/index.html): Medplum: Medical Collaboration (10 words) - [core.validateresourcetype | Medplum](/content/docs/sdk/core-validateresourcetype.html): Home > @medplum/core > validateResourceType (134 words) - [core.unaryoperatoratom | Medplum](/content/docs/sdk/core-unaryoperatoratom.html): Home > @medplum/core > UnaryOperatorAtom (49 words) - [core.valuesetexpandparams.date | Medplum](/content/docs/sdk/core-valuesetexpandparams-date.html): Home > @medplum/core > ValueSetExpandParams > date (8 words) - [decision-guides/messaging-docx.html](/content/decision-guides/messaging-docx.html) (1,773 words) - [core.valuesetexpandparams | Medplum](/content/docs/sdk/core-valuesetexpandparams.html): Home > @medplum/core > ValueSetExpandParams (56 words) - [core.typedeventtarget.addeventlistener | Medplum](/content/docs/sdk/core-typedeventtarget-addeventlistener.html): Home > @medplum/core > TypedEventTarget > addEventListener (30 words) - [core.transformmapcollection.get | Medplum](/content/docs/sdk/core-transformmapcollection-get.html): Home > @medplum/core > TransformMapCollection > get (29 words) - [core.typedeventtarget.dispatchevent | Medplum](/content/docs/sdk/core-typedeventtarget-dispatchevent.html): Home > @medplum/core > TypedEventTarget > dispatchEvent (20 words) - [core.unaryoperatoratom._constructor_ | Medplum](/content/docs/sdk/core-unaryoperatoratom-_constructor_.html): Home > @medplum/core > UnaryOperatorAtom > (constructor) (34 words) - [core.typedeventtarget.removeeventlistener | Medplum](/content/docs/sdk/core-typedeventtarget-removeeventlistener.html): Home > @medplum/core > TypedEventTarget > removeEventListener (30 words) - [core.unaryoperatoratom.impl | Medplum](/content/docs/sdk/core-unaryoperatoratom-impl.html): Home > @medplum/core > UnaryOperatorAtom > impl (17 words) - [core.valuesetexpandparams.displaylanguage | Medplum](/content/docs/sdk/core-valuesetexpandparams-displaylanguage.html): Home > @medplum/core > ValueSetExpandParams > displayLanguage (13 words) - [core.validatoroptions | Medplum](/content/docs/sdk/core-validatoroptions.html): Home > @medplum/core > ValidatorOptions (28 words) - [core.unescapetoken | Medplum](/content/docs/sdk/core-unescapetoken.html): Home > @medplum/core > unescapeToken (154 words) - [core.trygetdatatype | Medplum](/content/docs/sdk/core-trygetdatatype.html): Home > @medplum/core > tryGetDataType (29 words) - [core.unaryoperatoratom.eval | Medplum](/content/docs/sdk/core-unaryoperatoratom-eval.html): Home > @medplum/core > UnaryOperatorAtom > eval (21 words) - [core.validatoroptions.base64binarymaxbytes | Medplum](/content/docs/sdk/core-validatoroptions-base64binarymaxbytes.html): Home > @medplum/core > ValidatorOptions > base64BinaryMaxBytes (8 words) - [core.typedeventtarget | Medplum](/content/docs/sdk/core-typedeventtarget.html): Home > @medplum/core > TypedEventTarget (34 words) - [core.unionatom | Medplum](/content/docs/sdk/core-unionatom.html): Home > @medplum/core > UnionAtom (35 words) - [core.validatefhircastsubscriptionrequest | Medplum](/content/docs/sdk/core-validatefhircastsubscriptionrequest.html): Home > @medplum/core > validateFhircastSubscriptionRequest (35 words) - [core.typedvalue | Medplum](/content/docs/sdk/core-typedvalue.html): Home > @medplum/core > TypedValue (20 words) - [core.validatoroptions.profile | Medplum](/content/docs/sdk/core-validatoroptions-profile.html): Home > @medplum/core > ValidatorOptions > profile (13 words) - [core.validateresource | Medplum](/content/docs/sdk/core-validateresource.html): Home > @medplum/core > validateResource (25 words) - [core.valuesetexpandparams.filter | Medplum](/content/docs/sdk/core-valuesetexpandparams-filter.html): Home > @medplum/core > ValueSetExpandParams > filter (8 words) - [core.validatetypedvalue | Medplum](/content/docs/sdk/core-validatetypedvalue.html): Home > @medplum/core > validateTypedValue (22 words) - [core.unionatom._constructor_ | Medplum](/content/docs/sdk/core-unionatom-_constructor_.html): Home > @medplum/core > UnionAtom > (constructor) (22 words) - [core.valuesetexpandparams.count | Medplum](/content/docs/sdk/core-valuesetexpandparams-count.html): Home > @medplum/core > ValueSetExpandParams > count (7 words) - [core.tokenizer | Medplum](/content/docs/sdk/core-tokenizer.html): Home > @medplum/core > Tokenizer (48 words) - [core.typedvaluetostring | Medplum](/content/docs/sdk/core-typedvaluetostring.html): Home > @medplum/core > typedValueToString (46 words) - [Device | Medplum](/content/docs/api/fhir/resources/device/index.html): A type of a manufactured item that is used in the provision of healthcare without being substantially changed through that activity. The device may be a medical or non-medical device. For more on implantable devices, refer to US Core Implantable Device Profile. (2,495 words) - [core.trimtrailingemptyelements | Medplum](/content/docs/sdk/core-trimtrailingemptyelements.html): Home > @medplum/core > trimTrailingEmptyElements (87 words) - [core.unsupportedmediatype | Medplum](/content/docs/sdk/core-unsupportedmediatype.html): Home > @medplum/core > unsupportedMediaType (7 words) - [core.unauthorizedtokenaudience | Medplum](/content/docs/sdk/core-unauthorizedtokenaudience.html): Home > @medplum/core > unauthorizedTokenAudience (7 words) - [core.trygetprofile | Medplum](/content/docs/sdk/core-trygetprofile.html): Home > @medplum/core > tryGetProfile (24 words) - [core.typename | Medplum](/content/docs/sdk/core-typename.html): Home > @medplum/core > TypeName (34 words) - [core.transformmapcollection | Medplum](/content/docs/sdk/core-transformmapcollection.html): Home > @medplum/core > TransformMapCollection (64 words) - [core.typeinfo.searchparamsdetails | Medplum](/content/docs/sdk/core-typeinfo-searchparamsdetails.html): Home > @medplum/core > TypeInfo > searchParamsDetails (9 words) - [ChargeItem | Medplum](/content/docs/api/fhir/resources/chargeitem/index.html): The resource ChargeItem describes the provision of healthcare provider products for a certain patient, therefore referring not only to the product, but containing in addition details of the provision, like date, time, amounts and participating organizations and persons. Main Usage of the ChargeItem is to enable the billing process and internal cost allocation. (2,455 words) - [CompartmentDefinition | Medplum](/content/docs/api/fhir/resources/compartmentdefinition/index.html): A compartment definition that defines how resources are accessed on a server. (2,991 words) - [core.unaryoperatoratom.tostring | Medplum](/content/docs/sdk/core-unaryoperatoratom-tostring.html): Home > @medplum/core > UnaryOperatorAtom > toString (8 words) - [core.symbolatom | Medplum](/content/docs/sdk/core-symbolatom.html): Home > @medplum/core > SymbolAtom (65 words) - [core.validationerror | Medplum](/content/docs/sdk/core-validationerror.html): Home > @medplum/core > validationError (35 words) - [core.ucum | Medplum](/content/docs/sdk/core-ucum.html): Home > @medplum/core > UCUM (8 words) - [core.unauthorized | Medplum](/content/docs/sdk/core-unauthorized.html): Home > @medplum/core > unauthorized (5 words) - [core.websocketeventmap_2 | Medplum](/content/docs/sdk/core-websocketeventmap_2.html): Home > @medplum/core > WebSocketEventMap\2 (22 words) - [core.trygetjwtexpiration | Medplum](/content/docs/sdk/core-trygetjwtexpiration.html): Home > @medplum/core > tryGetJwtExpiration (54 words) - [core.tokenresponse | Medplum](/content/docs/sdk/core-tokenresponse.html): Home > @medplum/core > TokenResponse (37 words) - [core.toservicetypecodeableconcepts | Medplum](/content/docs/sdk/core-toservicetypecodeableconcepts.html): Home > @medplum/core > toServiceTypeCodeableConcepts (50 words) - [MeasureReport | Medplum](/content/docs/api/fhir/resources/measurereport/index.html): The MeasureReport resource contains the results of the calculation of a measure; and optionally a reference to the resources involved in that calculation. (2,592 words) - [core.typedvaluewithpath | Medplum](/content/docs/sdk/core-typedvaluewithpath.html): Home > @medplum/core > TypedValueWithPath (23 words) - [core.testoperation | Medplum](/content/docs/sdk/core-testoperation.html): Home > @medplum/core > TestOperation (20 words) - [core.toperiod | Medplum](/content/docs/sdk/core-toperiod.html): Home > @medplum/core > toPeriod (38 words) - [core.totypedvalue | Medplum](/content/docs/sdk/core-totypedvalue.html): Home > @medplum/core > toTypedValue (39 words) - [core.tokenscontext | Medplum](/content/docs/sdk/core-tokenscontext.html): Home > @medplum/core > TokensContext (17 words) - [core.tojsboolean | Medplum](/content/docs/sdk/core-tojsboolean.html): Home > @medplum/core > toJsBoolean (64 words) - [core.tokenresponse.token_type | Medplum](/content/docs/sdk/core-tokenresponse-token_type.html): Home > @medplum/core > TokenResponse > token\type (8 words) - [core.testerror._constructor_ | Medplum](/content/docs/sdk/core-testerror-_constructor_.html): Home > @medplum/core > TestError > (constructor) (22 words) - [core.tokenscontext.textsearchsystem | Medplum](/content/docs/sdk/core-tokenscontext-textsearchsystem.html): Home > @medplum/core > TokensContext > textSearchSystem (7 words) - [MessageHeader | Medplum](/content/docs/api/fhir/resources/messageheader/index.html): The header for a message exchange that is either requesting or responding to an action. The reference(s) that are the subject of the action as well as other information related to the action are typically transmitted in a bundle in which the MessageHeader resource instance is the first resource in the bundle. (2,055 words) - [core.tokenresponse.profile | Medplum](/content/docs/sdk/core-tokenresponse-profile.html): Home > @medplum/core > TokenResponse > profile (8 words) - [core.tokenizer._constructor_ | Medplum](/content/docs/sdk/core-tokenizer-_constructor_.html): Home > @medplum/core > Tokenizer > (constructor) (31 words) - [core.testoperation.value | Medplum](/content/docs/sdk/core-testoperation-value.html): Home > @medplum/core > TestOperation > value (7 words) - [core.tokenresponse.project | Medplum](/content/docs/sdk/core-tokenresponse-project.html): Home > @medplum/core > TokenResponse > project (14 words) - [core.sortrule | Medplum](/content/docs/sdk/core-sortrule.html): Home > @medplum/core > SortRule (19 words) - [core.sortstringarray | Medplum](/content/docs/sdk/core-sortstringarray.html): Home > @medplum/core > sortStringArray (46 words) - [core.subscriptionemitter | Medplum](/content/docs/sdk/core-subscriptionemitter.html): Home > @medplum/core > SubscriptionEmitter (118 words) - [core.tokenizer.tokenize | Medplum](/content/docs/sdk/core-tokenizer-tokenize.html): Home > @medplum/core > Tokenizer > tokenize (10 words) - [Condition | Medplum](/content/docs/api/fhir/resources/condition/index.html): A clinical condition, problem, diagnosis, or other event, situation, issue, or clinical concept that has risen to a level of concern. Refer to the US Core Condition profile and the US Core Condition Encounter profile. (2,424 words) - [core.tokenresponse.expires_in | Medplum](/content/docs/sdk/core-tokenresponse-expires_in.html): Home > @medplum/core > TokenResponse > expires\in (9 words) - [core.token.value | Medplum](/content/docs/sdk/core-token-value.html): Home > @medplum/core > Token > value (7 words) - [core.symbolatom.tostring | Medplum](/content/docs/sdk/core-symbolatom-tostring.html): Home > @medplum/core > SymbolAtom > toString (9 words) - [core.tokenresponse.id_token | Medplum](/content/docs/sdk/core-tokenresponse-id_token.html): Home > @medplum/core > TokenResponse > id\token (8 words) - [core.subscriptionmanager | Medplum](/content/docs/sdk/core-subscriptionmanager.html): Home > @medplum/core > SubscriptionManager (36 words) - [core.subscriptionmanager.addcriteria | Medplum](/content/docs/sdk/core-subscriptionmanager-addcriteria.html): Home > @medplum/core > SubscriptionManager > addCriteria (27 words) - [core.timezoneextensionuri | Medplum](/content/docs/sdk/core-timezoneextensionuri.html): Home > @medplum/core > TimezoneExtensionURI (8 words) - [core.symbolatom.eval | Medplum](/content/docs/sdk/core-symbolatom-eval.html): Home > @medplum/core > SymbolAtom > eval (18 words) - [core.literalatom | Medplum](/content/docs/sdk/core-literalatom.html): Home > @medplum/core > LiteralAtom (43 words) - [core.subtract | Medplum](/content/docs/sdk/core-subtract.html): Home > @medplum/core > subtract (103 words) - [core.submanageroptions.pingintervalms | Medplum](/content/docs/sdk/core-submanageroptions-pingintervalms.html): Home > @medplum/core > SubManagerOptions > pingIntervalMs (7 words) - [core.testerror.expected | Medplum](/content/docs/sdk/core-testerror-expected.html): Home > @medplum/core > TestError > expected (7 words) - [core.splitn | Medplum](/content/docs/sdk/core-splitn.html): Home > @medplum/core > splitN (84 words) - [core.summarizeobservations | Medplum](/content/docs/sdk/core-summarizeobservations.html): Home > @medplum/core > summarizeObservations (62 words) - [ImagingStudy | Medplum](/content/docs/api/fhir/resources/imagingstudy/index.html): Representation of the content produced in a DICOM imaging study. A study comprises a set of series, each of which includes a set of Service-Object Pair Instances (SOP Instances - images or other data) acquired or produced in a common context. A series is of only one modality (e.g. X-ray, CT, MR, ultrasound), but a study may have multiple series of different modalities. (3,230 words) - [core.submanageroptions | Medplum](/content/docs/sdk/core-submanageroptions.html): Home > @medplum/core > SubManagerOptions (29 words) - [core.subscriptionrequest | Medplum](/content/docs/sdk/core-subscriptionrequest.html): Home > @medplum/core > SubscriptionRequest (53 words) - [core.loginauthenticationresponse | Medplum](/content/docs/sdk/core-loginauthenticationresponse.html): Home > @medplum/core > LoginAuthenticationResponse (100 words) - [core.stringmap | Medplum](/content/docs/sdk/core-stringmap.html): Home > @medplum/core > StringMap (14 words) - [core.streamtobuffer | Medplum](/content/docs/sdk/core-streamtobuffer.html): Home > @medplum/core > streamToBuffer (66 words) - [core.subscriptionmanager.getmasteremitter | Medplum](/content/docs/sdk/core-subscriptionmanager-getmasteremitter.html): Home > @medplum/core > SubscriptionManager > getMasterEmitter (9 words) - [core.sumby | Medplum](/content/docs/sdk/core-sumby.html): Home > @medplum/core > sumBy (27 words) - [core.subscriptionmanager._constructor_ | Medplum](/content/docs/sdk/core-subscriptionmanager-_constructor_.html): Home > @medplum/core > SubscriptionManager > (constructor) (31 words) - [core.logger | Medplum](/content/docs/sdk/core-logger.html): Home > @medplum/core > Logger (73 words) - [core.symbolatom._constructor_ | Medplum](/content/docs/sdk/core-symbolatom-_constructor_.html): Home > @medplum/core > SymbolAtom > (constructor) (18 words) - [core.tokenizeroptions | Medplum](/content/docs/sdk/core-tokenizeroptions.html): Home > @medplum/core > TokenizerOptions (17 words) - [core.submanageroptions.debug | Medplum](/content/docs/sdk/core-submanageroptions-debug.html): Home > @medplum/core > SubManagerOptions > debug (13 words) - [core.subscriptionmanager.getwebsocket | Medplum](/content/docs/sdk/core-subscriptionmanager-getwebsocket.html): Home > @medplum/core > SubscriptionManager > getWebSocket (7 words) - [core.subscriptionmanager.getcriteriacount | Medplum](/content/docs/sdk/core-subscriptionmanager-getcriteriacount.html): Home > @medplum/core > SubscriptionManager > getCriteriaCount (9 words) - [core.logmessage | Medplum](/content/docs/sdk/core-logmessage.html): Home > @medplum/core > LogMessage (21 words) - [core.subscriptionmanager.reconnectifneeded | Medplum](/content/docs/sdk/core-subscriptionmanager-reconnectifneeded.html): Home > @medplum/core > SubscriptionManager > reconnectIfNeeded (7 words) - [core.smarthealthlinkpayload | Medplum](/content/docs/sdk/core-smarthealthlinkpayload.html): Home > @medplum/core > SmartHealthLinkPayload (30 words) - [core.iwebsocket | Medplum](/content/docs/sdk/core-iwebsocket.html): Home > @medplum/core > IWebSocket (248 words) - [core.testoperation.op | Medplum](/content/docs/sdk/core-testoperation-op.html): Home > @medplum/core > TestOperation > op (7 words) - [core.smarthealthlinkpayload.url | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-url.html): Home > @medplum/core > SmartHealthLinkPayload > url (7 words) - [core.loginauthenticationresponse.allowedmfamethods | Medplum](/content/docs/sdk/core-loginauthenticationresponse-allowedmfamethods.html): Home > @medplum/core > LoginAuthenticationResponse > allowedMfaMethods (25 words) - [core.stringify | Medplum](/content/docs/sdk/core-stringify.html): Home > @medplum/core > stringify (93 words) - [core.snomed | Medplum](/content/docs/sdk/core-snomed.html): Home > @medplum/core > SNOMED (6 words) - [core.loggerconfigoverride | Medplum](/content/docs/sdk/core-loggerconfigoverride.html): Home > @medplum/core > LoggerConfigOverride (12 words) - [core.smarthealthlinkpayload.v | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-v.html): Home > @medplum/core > SmartHealthLinkPayload > v (7 words) - [core.loginprofileresponse | Medplum](/content/docs/sdk/core-loginprofileresponse.html): Home > @medplum/core > LoginProfileResponse (17 words) - [core.logger.error | Medplum](/content/docs/sdk/core-logger-error.html): Home > @medplum/core > Logger > error (28 words) - [core.smarthealthlinkpayload.exp | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-exp.html): Home > @medplum/core > SmartHealthLinkPayload > exp (7 words) - [AuditEvent | Medplum](/content/docs/api/fhir/resources/auditevent/index.html): A record of an event made for purposes of maintaining a security log. Typical uses include detection of intrusion attempts and monitoring for inappropriate usage. (3,353 words) - [core.loginauthenticationresponse.enrollqrcode | Medplum](/content/docs/sdk/core-loginauthenticationresponse-enrollqrcode.html): Home > @medplum/core > LoginAuthenticationResponse > enrollQrCode (9 words) - [core.loginstate | Medplum](/content/docs/sdk/core-loginstate.html): Home > @medplum/core > LoginState (26 words) - [core.statsfn | Medplum](/content/docs/sdk/core-statsfn.html): Home > @medplum/core > StatsFn (15 words) - [core.smarthealthlinkpayload.key | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-key.html): Home > @medplum/core > SmartHealthLinkPayload > key (8 words) - [core.logmessage.msg | Medplum](/content/docs/sdk/core-logmessage-msg.html): Home > @medplum/core > LogMessage > msg (7 words) - [core.loginstate.accesstoken | Medplum](/content/docs/sdk/core-loginstate-accesstoken.html): Home > @medplum/core > LoginState > accessToken (14 words) - [core.loglevel | Medplum](/content/docs/sdk/core-loglevel.html): Home > @medplum/core > LogLevel (44 words) - [core.loginprofileresponse.scope | Medplum](/content/docs/sdk/core-loginprofileresponse-scope.html): Home > @medplum/core > LoginProfileResponse > scope (8 words) - [core.loglevelnames | Medplum](/content/docs/sdk/core-loglevelnames.html): Home > @medplum/core > LogLevelNames (10 words) - [core.loginstate.project | Medplum](/content/docs/sdk/core-loginstate-project.html): Home > @medplum/core > LoginState > project (8 words) - [core.loginstate.refreshtoken | Medplum](/content/docs/sdk/core-loginstate-refreshtoken.html): Home > @medplum/core > LoginState > refreshToken (14 words) - [core.loginscoperesponse | Medplum](/content/docs/sdk/core-loginscoperesponse.html): Home > @medplum/core > LoginScopeResponse (17 words) - [core.loginauthenticationresponse.login | Medplum](/content/docs/sdk/core-loginauthenticationresponse-login.html): Home > @medplum/core > LoginAuthenticationResponse > login (8 words) - [core.loginscoperesponse.code | Medplum](/content/docs/sdk/core-loginscoperesponse-code.html): Home > @medplum/core > LoginScopeResponse > code (14 words) - [core.loginprofileresponse.login | Medplum](/content/docs/sdk/core-loginprofileresponse-login.html): Home > @medplum/core > LoginProfileResponse > login (8 words) - [core.loginscoperesponse.login | Medplum](/content/docs/sdk/core-loginscoperesponse-login.html): Home > @medplum/core > LoginScopeResponse > login (8 words) - [core.loginauthenticationresponse.mfamethods | Medplum](/content/docs/sdk/core-loginauthenticationresponse-mfamethods.html): Home > @medplum/core > LoginAuthenticationResponse > mfaMethods (24 words) - [core.loggerconfig | Medplum](/content/docs/sdk/core-loggerconfig.html): Home > @medplum/core > LoggerConfig (23 words) - [core.logger._constructor_ | Medplum](/content/docs/sdk/core-logger-_constructor_.html): Home > @medplum/core > Logger > (constructor) (43 words) - [EventDefinition | Medplum](/content/docs/api/fhir/resources/eventdefinition/index.html): The EventDefinition resource provides a reusable description of when a particular event can occur. (2,825 words) - [Goal | Medplum](/content/docs/api/fhir/resources/goal/index.html): Describes the intended objective(s) for a patient, group or organization care, for example, weight loss, restoring an activity of daily living, obtaining herd immunity via immunization, meeting a process improvement objective, etc. Refer to the US Core Goal profile. (2,051 words) - [core.loginauthenticationresponse.email | Medplum](/content/docs/sdk/core-loginauthenticationresponse-email.html): Home > @medplum/core > LoginAuthenticationResponse > email (28 words) - [core.loginauthenticationresponse.mfaenrollrequired | Medplum](/content/docs/sdk/core-loginauthenticationresponse-mfaenrollrequired.html): Home > @medplum/core > LoginAuthenticationResponse > mfaEnrollRequired (8 words) - [core.logger.info | Medplum](/content/docs/sdk/core-logger-info.html): Home > @medplum/core > Logger > info (28 words) - [core.loginauthenticationresponse.code | Medplum](/content/docs/sdk/core-loginauthenticationresponse-code.html): Home > @medplum/core > LoginAuthenticationResponse > code (8 words) - [core.logger.warn | Medplum](/content/docs/sdk/core-logger-warn.html): Home > @medplum/core > Logger > warn (34 words) - [core.jwtpayload | Medplum](/content/docs/sdk/core-jwtpayload.html): Home > @medplum/core > JWTPayload (77 words) - [core.logger.clone | Medplum](/content/docs/sdk/core-logger-clone.html): Home > @medplum/core > Logger > clone (15 words) - [core.literalatom._constructor_ | Medplum](/content/docs/sdk/core-literalatom-_constructor_.html): Home > @medplum/core > LiteralAtom > (constructor) (20 words) - [core.loginauthenticationresponse.emailverificationrequired | Medplum](/content/docs/sdk/core-loginauthenticationresponse-emailverificationrequired.html): Home > @medplum/core > LoginAuthenticationResponse > emailVerificationRequired (8 words) - [core.loggeroptions | Medplum](/content/docs/sdk/core-loggeroptions.html): Home > @medplum/core > LoggerOptions (16 words) - [core.loggeroptions.prefix | Medplum](/content/docs/sdk/core-loggeroptions-prefix.html): Home > @medplum/core > LoggerOptions > prefix (7 words) - [core.jwtpayload.nbf | Medplum](/content/docs/sdk/core-jwtpayload-nbf.html): Home > @medplum/core > JWTPayload > nbf (10 words) - [core.logger.log | Medplum](/content/docs/sdk/core-logger-log.html): Home > @medplum/core > Logger > log (32 words) - [core.iwebsocketeventmap | Medplum](/content/docs/sdk/core-iwebsocketeventmap.html): Home > @medplum/core > IWebSocketEventMap (86 words) - [core.loggerconfig.write | Medplum](/content/docs/sdk/core-loggerconfig-write.html): Home > @medplum/core > LoggerConfig > write (16 words) - [core.iwebsocket.addeventlistener | Medplum](/content/docs/sdk/core-iwebsocket-addeventlistener.html): Home > @medplum/core > IWebSocket > addEventListener (37 words) - [core.logger.write | Medplum](/content/docs/sdk/core-logger-write.html): Home > @medplum/core > Logger > write (11 words) - [core.literalatom.eval | Medplum](/content/docs/sdk/core-literalatom-eval.html): Home > @medplum/core > LiteralAtom > eval (9 words) - [core.locationutils | Medplum](/content/docs/sdk/core-locationutils.html): Home > @medplum/core > locationUtils (45 words) - [core.logger.debug | Medplum](/content/docs/sdk/core-logger-debug.html): Home > @medplum/core > Logger > debug (28 words) - [core.literalatom.tostring | Medplum](/content/docs/sdk/core-literalatom-tostring.html): Home > @medplum/core > LiteralAtom > toString (10 words) - [core.literalatom.value | Medplum](/content/docs/sdk/core-literalatom-value.html): Home > @medplum/core > LiteralAtom > value (14 words) - [core.jwtpayload.jti | Medplum](/content/docs/sdk/core-jwtpayload-jti.html): Home > @medplum/core > JWTPayload > jti (9 words) - [core.logger.level | Medplum](/content/docs/sdk/core-logger-level.html): Home > @medplum/core > Logger > level (13 words) - [core.logger.metadata | Medplum](/content/docs/sdk/core-logger-metadata.html): Home > @medplum/core > Logger > metadata (9 words) - [core.loaddatatype | Medplum](/content/docs/sdk/core-loaddatatype.html): Home > @medplum/core > loadDataType (20 words) - [core.iwebsocket.url | Medplum](/content/docs/sdk/core-iwebsocket-url.html): Home > @medplum/core > IWebSocket > url (8 words) - [core.jwtpayload.sub | Medplum](/content/docs/sdk/core-jwtpayload-sub.html): Home > @medplum/core > JWTPayload > sub (9 words) - [DocumentReference | Medplum](/content/docs/api/fhir/resources/documentreference/index.html): A reference to a document of any kind for any purpose. Provides metadata about the document so that the document can be discovered and managed. The scope of a document is any seralized object with a mime-type, so includes formal patient centric documents (CDA), clinical notes, scanned paper, and non-patient specific documents like policy text. Refer to the US Core DocumentReference profile. (2,085 words) - [Invoice | Medplum](/content/docs/api/fhir/resources/invoice/index.html): Invoice containing collected ChargeItems from an Account with calculated individual and total price for Billing purpose. (3,123 words) - [core.lazy | Medplum](/content/docs/sdk/core-lazy.html): Home > @medplum/core > lazy (47 words) - [core.jwtpayload.aud | Medplum](/content/docs/sdk/core-jwtpayload-aud.html): Home > @medplum/core > JWTPayload > aud (10 words) - [core.isuuid | Medplum](/content/docs/sdk/core-isuuid.html): Home > @medplum/core > isUUID (51 words) - [core.isvalidmedplumsemver | Medplum](/content/docs/sdk/core-isvalidmedplumsemver.html): Home > @medplum/core > isValidMedplumSemver (71 words) - [core.isvalidhostname | Medplum](/content/docs/sdk/core-isvalidhostname.html): Home > @medplum/core > isValidHostname (87 words) - [core.isvaliddate | Medplum](/content/docs/sdk/core-isvaliddate.html): Home > @medplum/core > isValidDate (51 words) - [core.iwebsocket.removeeventlistener | Medplum](/content/docs/sdk/core-iwebsocket-removeeventlistener.html): Home > @medplum/core > IWebSocket > removeEventListener (45 words) - [core.jwtpayload.iat | Medplum](/content/docs/sdk/core-jwtpayload-iat.html): Home > @medplum/core > JWTPayload > iat (10 words) - [core.iwebsocket.removeeventlistener_1 | Medplum](/content/docs/sdk/core-iwebsocket-removeeventlistener_1.html): Home > @medplum/core > IWebSocket > removeEventListener (30 words) - [core.jwtpayload.iss | Medplum](/content/docs/sdk/core-jwtpayload-iss.html): Home > @medplum/core > JWTPayload > iss (9 words) - [core.iwebsocket.bufferedamount | Medplum](/content/docs/sdk/core-iwebsocket-bufferedamount.html): Home > @medplum/core > IWebSocket > bufferedAmount (14 words) - [core.jwtpayload.exp | Medplum](/content/docs/sdk/core-jwtpayload-exp.html): Home > @medplum/core > JWTPayload > exp (9 words) - [core.iwebsocket.close | Medplum](/content/docs/sdk/core-iwebsocket-close.html): Home > @medplum/core > IWebSocket > close (22 words) - [MessageDefinition | Medplum](/content/docs/api/fhir/resources/messagedefinition/index.html): Defines the characteristics of a message that can be shared between systems, including the type of event that initiates the message, the content to be transmitted and what response(s), if any, are permitted. (2,670 words) - [Appointment | Medplum](/content/docs/api/fhir/resources/appointment/index.html): A booking of a healthcare event among patient(s), practitioner(s), related person(s) and/or device(s) for a specific date/time. This may result in one or more Encounter(s). (2,506 words) - [core.iwebsocket.addeventlistener_1 | Medplum](/content/docs/sdk/core-iwebsocket-addeventlistener_1.html): Home > @medplum/core > IWebSocket > addEventListener (30 words) - [core.iwebsocket.connecting | Medplum](/content/docs/sdk/core-iwebsocket-connecting.html): Home > @medplum/core > IWebSocket > CONNECTING (8 words) - [core.iwebsocket.send | Medplum](/content/docs/sdk/core-iwebsocket-send.html): Home > @medplum/core > IWebSocket > send (23 words) - [core.iwebsocket.binarytype | Medplum](/content/docs/sdk/core-iwebsocket-binarytype.html): Home > @medplum/core > IWebSocket > binaryType (8 words) - [DiagnosticReport | Medplum](/content/docs/api/fhir/resources/diagnosticreport/index.html): The findings and interpretation of diagnostic tests performed on patients, groups of patients, devices, and locations, and/or specimens derived from these. The report includes clinical context such as requesting and provider information, and some mix of atomic results, images, textual and coded interpretations, and formatted representation of diagnostic reports. Refer to the US Core DiagnosticReport profile for Report and Note exchange. (2,412 words) - [decision-guides/referrals-docx.html](/content/decision-guides/referrals-docx.html) (2,469 words) - [core.iwebsocket.closed | Medplum](/content/docs/sdk/core-iwebsocket-closed.html): Home > @medplum/core > IWebSocket > CLOSED (12 words) - [core.isprofileresource | Medplum](/content/docs/sdk/core-isprofileresource.html): Home > @medplum/core > isProfileResource (39 words) - [core.iwebsocket.protocol | Medplum](/content/docs/sdk/core-iwebsocket-protocol.html): Home > @medplum/core > IWebSocket > protocol (8 words) - [Media | Medplum](/content/docs/api/fhir/resources/media/index.html): A photo, video, or audio recording acquired or used in healthcare. The actual content may be inline or provided by direct reference. (2,241 words) - [core.asynccrawlervisitor | Medplum](/content/docs/sdk/core-asynccrawlervisitor.html): Home > @medplum/core > AsyncCrawlerVisitor (60 words) - [core.iwebsocket.extensions | Medplum](/content/docs/sdk/core-iwebsocket-extensions.html): Home > @medplum/core > IWebSocket > extensions (9 words) - [Location | Medplum](/content/docs/api/fhir/resources/location/index.html): Details and position information for a physical place where services are provided and resources and participants may be stored, found, contained, or accommodated. (2,348 words) - [Composition | Medplum](/content/docs/api/fhir/resources/composition/index.html): A set of healthcare-related information that is assembled together into a single logical package that provides a single coherent statement of meaning, establishes its own context and that has clinical attestation with regard to who is making the statement. A Composition defines the structure and narrative content necessary for a document. However, a Composition alone does not constitute a document. Rather, the Composition must be the first entry in a Bundle where Bundle.type=document, and any other resources referenced from Composition must be included as subsequent entries in the Bundle (for example Patient, Practitioner, Encounter, etc.). (2,468 words) - [core.isnotfound | Medplum](/content/docs/sdk/core-isnotfound.html): Home > @medplum/core > isNotFound (26 words) - [core.isresourcetype | Medplum](/content/docs/sdk/core-isresourcetype.html): Home > @medplum/core > isResourceType (56 words) - [core.istypedvalue | Medplum](/content/docs/sdk/core-istypedvalue.html): Home > @medplum/core > isTypedValue (44 words) - [core.istextobject | Medplum](/content/docs/sdk/core-istextobject.html): Home > @medplum/core > isTextObject (66 words) - [core.isunauthenticated | Medplum](/content/docs/sdk/core-isunauthenticated.html): Home > @medplum/core > isUnauthenticated (20 words) - [ImmunizationRecommendation | Medplum](/content/docs/api/fhir/resources/immunizationrecommendation/index.html): A patient's point-in-time set of recommendations (i.e. forecasting) according to a published schedule with optional supporting justification. (1,949 words) - [core.isstringarray | Medplum](/content/docs/sdk/core-isstringarray.html): Home > @medplum/core > isStringArray (44 words) - [core.isresourcetypeschema | Medplum](/content/docs/sdk/core-isresourcetypeschema.html): Home > @medplum/core > isResourceTypeSchema (46 words) - [core.isresourcewithid | Medplum](/content/docs/sdk/core-isresourcewithid.html): Home > @medplum/core > isResourceWithId (31 words) - [core.arraybuffertohex | Medplum](/content/docs/sdk/core-arraybuffertohex.html): Home > @medplum/core > arrayBufferToHex (40 words) - [core.isslicedefinitionwithtypes | Medplum](/content/docs/sdk/core-isslicedefinitionwithtypes.html): Home > @medplum/core > isSliceDefinitionWithTypes (24 words) - [core.isnodeenvironment | Medplum](/content/docs/sdk/core-isnodeenvironment.html): Home > @medplum/core > isNodeEnvironment (27 words) - [core.isprofileloaded | Medplum](/content/docs/sdk/core-isprofileloaded.html): Home > @medplum/core > isProfileLoaded (22 words) - [core.assertok | Medplum](/content/docs/sdk/core-assertok.html): Home > @medplum/core > assertOk (59 words) - [MedicinalProduct | Medplum](/content/docs/api/fhir/resources/medicinalproduct/index.html): Detailed definition of a medicinal product, typically for uses other than direct patient care (e.g. regulatory use). (1,298 words) - [Immunization | Medplum](/content/docs/api/fhir/resources/immunization/index.html): Describes the event of a patient being administered a vaccine or a record of an immunization as reported by a patient, a clinician or another party. Refer to the US Core Immunizations profile. (2,583 words) - [core.assertnever | Medplum](/content/docs/sdk/core-assertnever.html): Home > @medplum/core > assertNever (77 words) - [core.asatom | Medplum](/content/docs/sdk/core-asatom.html): Home > @medplum/core > AsAtom (51 words) - [core.issueseverity | Medplum](/content/docs/sdk/core-issueseverity.html): Home > @medplum/core > IssueSeverity (16 words) - [core.isstring | Medplum](/content/docs/sdk/core-isstring.html): Home > @medplum/core > isString (50 words) - [core.asynccrawlervisitor.onexitobject | Medplum](/content/docs/sdk/core-asynccrawlervisitor-onexitobject.html): Home > @medplum/core > AsyncCrawlerVisitor > onExitObject (15 words) - [core.isquantity | Medplum](/content/docs/sdk/core-isquantity.html): Home > @medplum/core > isQuantity (55 words) - [Coverage | Medplum](/content/docs/api/fhir/resources/coverage/index.html): Financial instrument which may be used to reimburse or pay for health care products and services. Includes both insurance and self-payment. (2,279 words) - [core.isprimitivetype | Medplum](/content/docs/sdk/core-isprimitivetype.html): Home > @medplum/core > isPrimitiveType (41 words) - [core.isquantityequivalent | Medplum](/content/docs/sdk/core-isquantityequivalent.html): Home > @medplum/core > isQuantityEquivalent (24 words) - [core.atom | Medplum](/content/docs/sdk/core-atom.html): Home > @medplum/core > Atom (15 words) - [DeviceRequest | Medplum](/content/docs/api/fhir/resources/devicerequest/index.html): Represents a request for a patient to employ a medical device. The device may be an implantable device, or an external assistive device, such as a walker. (1,984 words) - [core.atom.eval | Medplum](/content/docs/sdk/core-atom-eval.html): Home > @medplum/core > Atom > eval (23 words) - [core.isredirect | Medplum](/content/docs/sdk/core-isredirect.html): Home > @medplum/core > isRedirect (20 words) - [core.isreference | Medplum](/content/docs/sdk/core-isreference.html): Home > @medplum/core > isReference (79 words) - [core.asynccrawlervisitor.visitpropertyasync | Medplum](/content/docs/sdk/core-asynccrawlervisitor-visitpropertyasync.html): Home > @medplum/core > AsyncCrawlerVisitor > visitPropertyAsync (21 words) - [core.asynccrawlervisitor.onexitresource | Medplum](/content/docs/sdk/core-asynccrawlervisitor-onexitresource.html): Home > @medplum/core > AsyncCrawlerVisitor > onExitResource (14 words) - [core.assertvalidmedplumsemver | Medplum](/content/docs/sdk/core-assertvalidmedplumsemver.html): Home > @medplum/core > assertValidMedplumSemver (26 words) - [core.arithmeticoperatoratom | Medplum](/content/docs/sdk/core-arithmeticoperatoratom.html): Home > @medplum/core > ArithmeticOperatorAtom (57 words) - [core.asynccrawlervisitor.onenterobject | Medplum](/content/docs/sdk/core-asynccrawlervisitor-onenterobject.html): Home > @medplum/core > AsyncCrawlerVisitor > onEnterObject (15 words) - [core.asatom.eval | Medplum](/content/docs/sdk/core-asatom-eval.html): Home > @medplum/core > AsAtom > eval (27 words) - [core.asatom._constructor_ | Medplum](/content/docs/sdk/core-asatom-_constructor_.html): Home > @medplum/core > AsAtom > (constructor) (22 words) - [core.isok | Medplum](/content/docs/sdk/core-isok.html): Home > @medplum/core > isOk (20 words) - [core.isoperationoutcome | Medplum](/content/docs/sdk/core-isoperationoutcome.html): Home > @medplum/core > isOperationOutcome (24 words) - [core.isperiod | Medplum](/content/docs/sdk/core-isperiod.html): Home > @medplum/core > isPeriod (52 words) - [core.assertcontextversionoptional | Medplum](/content/docs/sdk/core-assertcontextversionoptional.html): Home > @medplum/core > assertContextVersionOptional (23 words) - [core.applydefaultvaluestoelement | Medplum](/content/docs/sdk/core-applydefaultvaluestoelement.html): Home > @medplum/core > applyDefaultValuesToElement (115 words) - [Medication | Medplum](/content/docs/api/fhir/resources/medication/index.html): This resource is primarily used for the identification and definition of a medication for the purposes of prescribing, dispensing, and administering a medication as well as for making statements about medication use. Refer to the US Core Medication profile. (2,147 words) - [core.asynccrawlervisitor.onenterresource | Medplum](/content/docs/sdk/core-asynccrawlervisitor-onenterresource.html): Home > @medplum/core > AsyncCrawlerVisitor > onEnterResource (14 words) - [Library | Medplum](/content/docs/api/fhir/resources/library/index.html): The Library resource is a general-purpose container for knowledge asset definitions. It can be used to describe and expose existing knowledge assets such as logic libraries and information model descriptions, as well as to describe a collection of knowledge assets. (1,926 words) - [core.applydefaultvaluestoresource | Medplum](/content/docs/sdk/core-applydefaultvaluestoresource.html): Home > @medplum/core > applyDefaultValuesToResource (94 words) - [core.apply | Medplum](/content/docs/sdk/core-apply.html): Home > @medplum/core > apply (75 words) - [core.applypatch | Medplum](/content/docs/sdk/core-applypatch.html): Home > @medplum/core > applyPatch (135 words) - [core.assertreleasemanifest | Medplum](/content/docs/sdk/core-assertreleasemanifest.html): Home > @medplum/core > assertReleaseManifest (38 words) - [core.andatom | Medplum](/content/docs/sdk/core-andatom.html): Home > @medplum/core > AndAtom (57 words) - [AdverseEvent | Medplum](/content/docs/api/fhir/resources/adverseevent/index.html): Actual or potential/avoided event causing unintended physical injury resulting from or contributed to by medical care, a research study or other healthcare setting factors that requires additional monitoring, treatment, or hospitalization, or that results in death. (2,162 words) - [core.applyfixedorpatternvalue | Medplum](/content/docs/sdk/core-applyfixedorpatternvalue.html): Home > @medplum/core > applyFixedOrPatternValue (35 words) - [core.agenttransmitresponse.statuscode | Medplum](/content/docs/sdk/core-agenttransmitresponse-statuscode.html): Home > @medplum/core > AgentTransmitResponse > statusCode (8 words) - [core.arithmeticoperatoratom.eval | Medplum](/content/docs/sdk/core-arithmeticoperatoratom-eval.html): Home > @medplum/core > ArithmeticOperatorAtom > eval (21 words) - [core.andatom.eval | Medplum](/content/docs/sdk/core-andatom-eval.html): Home > @medplum/core > AndAtom > eval (23 words) - [MedicationStatement | Medplum](/content/docs/api/fhir/resources/medicationstatement/index.html): A record of a medication that is being consumed by a patient. A MedicationStatement may indicate that the patient may be taking the medication now or has taken the medication in the past or will be taking the medication in the future. The source of this information can be the patient, significant other (such as a family member or spouse), or a clinician. A common scenario where this information is captured is during the history taking process during a patient visit or stay. The medication information may come from sources such as the patient's memory, from a prescription bottle, or from a list of medications the patient, clinician or other party maintains. The primary difference between a medication statement and a medication administration is that the medication administration has complete administration information and is based on actual administration information from the person who administered the medication. A medication statement is often, if not always, less specific. There is no required date/time when the medication was administered, in fact we only know that a source has reported the patient is taking this medication, where details such as time, quantity, or rate or even medication product may be incomplete or missing or less precise. As stated earlier, the medication statement information may come from the patient's memory, from a prescription bottle or from a list of medications the patient, clinician or other party maintains. Medication administration is more formal and is not missing detailed information. (1,878 words) - [core.anchorresourceopenevent | Medplum](/content/docs/sdk/core-anchorresourceopenevent.html): Home > @medplum/core > AnchorResourceOpenEvent (24 words) - [core.arithmeticoperatoratom._constructor_ | Medplum](/content/docs/sdk/core-arithmeticoperatoratom-_constructor_.html): Home > @medplum/core > ArithmeticOperatorAtom > (constructor) (45 words) - [core.arrayify_1 | Medplum](/content/docs/sdk/core-arrayify_1.html): Home > @medplum/core > arrayify (32 words) - [core.arraybuffertobase64 | Medplum](/content/docs/sdk/core-arraybuffertobase64.html): Home > @medplum/core > arrayBufferToBase64 (36 words) - [core.agentupgraderesponse.type | Medplum](/content/docs/sdk/core-agentupgraderesponse-type.html): Home > @medplum/core > AgentUpgradeResponse > type (7 words) - [core.agentupgraderesponse | Medplum](/content/docs/sdk/core-agentupgraderesponse.html): Home > @medplum/core > AgentUpgradeResponse (24 words) - [core.arrayify | Medplum](/content/docs/sdk/core-arrayify.html): Home > @medplum/core > arrayify (24 words) - [core.andatom._constructor_ | Medplum](/content/docs/sdk/core-andatom-_constructor_.html): Home > @medplum/core > AndAtom > (constructor) (22 words) - [core.agenttransmitrequest | Medplum](/content/docs/sdk/core-agenttransmitrequest.html): Home > @medplum/core > AgentTransmitRequest (32 words) - [core.allok | Medplum](/content/docs/sdk/core-allok.html): Home > @medplum/core > allOk (6 words) - [core.agentupgraderequest | Medplum](/content/docs/sdk/core-agentupgraderequest.html): Home > @medplum/core > AgentUpgradeRequest (28 words) - [MedicinalProductPharmaceutical | Medplum](/content/docs/api/fhir/resources/medicinalproductpharmaceutical/index.html): A pharmaceutical product described in terms of its composition and dose form. (1,208 words) - [MedicinalProductPackaged | Medplum](/content/docs/api/fhir/resources/medicinalproductpackaged/index.html): A medicinal product in a container or package. (1,451 words) - [ActivityDefinition | Medplum](/content/docs/api/fhir/resources/activitydefinition/index.html): This resource allows for the definition of some activity to be performed, independent of a particular patient, practitioner, or other performance context. (3,387 words) - [core.agentupgraderesponse.statuscode | Medplum](/content/docs/sdk/core-agentupgraderesponse-statuscode.html): Home > @medplum/core > AgentUpgradeResponse > statusCode (8 words) - [medplum #rules](/content/linen/c/rules/index.html): Medplum is the fasted way to build high quality, scalable and compliant healthcare applications medplum #rules Latest (9 words) - [core.agenttransmitresponse | Medplum](/content/docs/sdk/core-agenttransmitresponse.html): Home > @medplum/core > AgentTransmitResponse (43 words) - [core.append | Medplum](/content/docs/sdk/core-append.html): Home > @medplum/core > append (27 words) - [core.agentupgraderequest.version | Medplum](/content/docs/sdk/core-agentupgraderequest-version.html): Home > @medplum/core > AgentUpgradeRequest > version (7 words) - [core.agenttransmitresponse.contenttype | Medplum](/content/docs/sdk/core-agenttransmitresponse-contenttype.html): Home > @medplum/core > AgentTransmitResponse > contentType (8 words) - [core.agentupgraderequest.type | Medplum](/content/docs/sdk/core-agentupgraderequest-type.html): Home > @medplum/core > AgentUpgradeRequest > type (8 words) - [core.agentupgraderequest.force | Medplum](/content/docs/sdk/core-agentupgraderequest-force.html): Home > @medplum/core > AgentUpgradeRequest > force (8 words) - [core.agenttransmitresponse.type | Medplum](/content/docs/sdk/core-agenttransmitresponse-type.html): Home > @medplum/core > AgentTransmitResponse > type (8 words) - [core.agentstatsresponse | Medplum](/content/docs/sdk/core-agentstatsresponse.html): Home > @medplum/core > AgentStatsResponse (24 words) - [core.agenttransmitresponse.remote | Medplum](/content/docs/sdk/core-agenttransmitresponse-remote.html): Home > @medplum/core > AgentTransmitResponse > remote (7 words) - [ClaimResponse | Medplum](/content/docs/api/fhir/resources/claimresponse/index.html): This resource provides the adjudication details from the processing of a Claim resource. (1,454 words) - [core.agenttransmitresponse.channel | Medplum](/content/docs/sdk/core-agenttransmitresponse-channel.html): Home > @medplum/core > AgentTransmitResponse > channel (8 words) - [Evidence | Medplum](/content/docs/api/fhir/resources/evidence/index.html): The Evidence resource describes the conditional state (population and any exposures being compared within the population) and outcome (if specified) that the knowledge (evidence, assertion, recommendation) is about. (2,555 words) - [core.agentstatsresponse.type | Medplum](/content/docs/sdk/core-agentstatsresponse-type.html): Home > @medplum/core > AgentStatsResponse > type (7 words) - [core.agenttransmitrequest.contenttype | Medplum](/content/docs/sdk/core-agenttransmitrequest-contenttype.html): Home > @medplum/core > AgentTransmitRequest > contentType (7 words) - [core.agenttransmitrequest.remote | Medplum](/content/docs/sdk/core-agenttransmitrequest-remote.html): Home > @medplum/core > AgentTransmitRequest > remote (8 words) - [core.agenttransmitrequest.type | Medplum](/content/docs/sdk/core-agenttransmitrequest-type.html): Home > @medplum/core > AgentTransmitRequest > type (7 words) - [core.agenttransmitresponse.body | Medplum](/content/docs/sdk/core-agenttransmitresponse-body.html): Home > @medplum/core > AgentTransmitResponse > body (8 words) - [core.agentstatvalue | Medplum](/content/docs/sdk/core-agentstatvalue.html): Home > @medplum/core > AgentStatValue (22 words) - [core.agenttransmitrequest.returnack | Medplum](/content/docs/sdk/core-agenttransmitrequest-returnack.html): Home > @medplum/core > AgentTransmitRequest > returnAck (7 words) - [core.agentstatsresponse.statuscode | Medplum](/content/docs/sdk/core-agentstatsresponse-statuscode.html): Home > @medplum/core > AgentStatsResponse > statusCode (7 words) - [core.agentstatsresponse.stats | Medplum](/content/docs/sdk/core-agentstatsresponse-stats.html): Home > @medplum/core > AgentStatsResponse > stats (13 words) - [core.agenttransmitrequest.channel | Medplum](/content/docs/sdk/core-agenttransmitrequest-channel.html): Home > @medplum/core > AgentTransmitRequest > channel (7 words) - [core.agentstatsrequest | Medplum](/content/docs/sdk/core-agentstatsrequest.html): Home > @medplum/core > AgentStatsRequest (20 words) - [core.agenttransmitrequest.body | Medplum](/content/docs/sdk/core-agenttransmitrequest-body.html): Home > @medplum/core > AgentTransmitRequest > body (7 words) - [List | Medplum](/content/docs/api/fhir/resources/list/index.html): A list is a curated collection of resources. (1,676 words) - [core.agentstatsrequest.type | Medplum](/content/docs/sdk/core-agentstatsrequest-type.html): Home > @medplum/core > AgentStatsRequest > type (7 words) - [core.agentstats.websocketqueuedepth | Medplum](/content/docs/sdk/core-agentstats-websocketqueuedepth.html): Home > @medplum/core > AgentStats > webSocketQueueDepth (8 words) - [core.agentstats | Medplum](/content/docs/sdk/core-agentstats.html): Home > @medplum/core > AgentStats (56 words) - [core.agentstats.live | Medplum](/content/docs/sdk/core-agentstats-live.html): Home > @medplum/core > AgentStats > live (7 words) - [FamilyMemberHistory | Medplum](/content/docs/api/fhir/resources/familymemberhistory/index.html): Significant health conditions for a person related to the patient relevant in the context of care for the patient. (1,449 words) - [core.agentstats.hl7queuedepth | Medplum](/content/docs/sdk/core-agentstats-hl7queuedepth.html): Home > @medplum/core > AgentStats > hl7QueueDepth (8 words) - [core.agentstats.hl7clientcount | Medplum](/content/docs/sdk/core-agentstats-hl7clientcount.html): Home > @medplum/core > AgentStats > hl7ClientCount (8 words) - [core.agentstats.outstandingheartbeats | Medplum](/content/docs/sdk/core-agentstats-outstandingheartbeats.html): Home > @medplum/core > AgentStats > outstandingHeartbeats (8 words) - [core.agentstats.ping | Medplum](/content/docs/sdk/core-agentstats-ping.html): Home > @medplum/core > AgentStats > ping (7 words) - [core.agentstats.hl7connectionsopen | Medplum](/content/docs/sdk/core-agentstats-hl7connectionsopen.html): Home > @medplum/core > AgentStats > hl7ConnectionsOpen (5 words) - [core.agentrequestmessage | Medplum](/content/docs/sdk/core-agentrequestmessage.html): Home > @medplum/core > AgentRequestMessage (36 words) - [core.agentstats.clientstats | Medplum](/content/docs/sdk/core-agentstats-clientstats.html): Home > @medplum/core > AgentStats > clientStats (8 words) - [CommunicationRequest | Medplum](/content/docs/api/fhir/resources/communicationrequest/index.html): A request to convey information; e.g. the CDS system proposes that an alert be sent to a responsible provider, the CDS system proposes that the public health agency be notified about a reportable condition. (1,497 words) - [Group | Medplum](/content/docs/api/fhir/resources/group/index.html): Represents a defined collection of entities that may be discussed or acted upon collectively but which are not expected to act collectively, and are not formally or legally recognized; i.e. a collection of entities that isn't an Organization. (1,141 words) - [core.agentstats.channelstats | Medplum](/content/docs/sdk/core-agentstats-channelstats.html): Home > @medplum/core > AgentStats > channelStats (9 words) - [MedicinalProductInteraction | Medplum](/content/docs/api/fhir/resources/medicinalproductinteraction/index.html): The interactions of the medicinal product with other medicinal products, or other forms of interactions. (1,391 words) - [core.agentreloadconfigresponse.type | Medplum](/content/docs/sdk/core-agentreloadconfigresponse-type.html): Home > @medplum/core > AgentReloadConfigResponse > type (13 words) - [core.agentreloadconfigrequest.type | Medplum](/content/docs/sdk/core-agentreloadconfigrequest-type.html): Home > @medplum/core > AgentReloadConfigRequest > type (8 words) - [core.agentrttstats | Medplum](/content/docs/sdk/core-agentrttstats.html): Home > @medplum/core > AgentRttStats (27 words) - [core.agentresponsemessage | Medplum](/content/docs/sdk/core-agentresponsemessage.html): Home > @medplum/core > AgentResponseMessage (33 words) - [ImmunizationEvaluation | Medplum](/content/docs/api/fhir/resources/immunizationevaluation/index.html): Describes a comparison of an immunization event against published recommendations to determine if the administration is "valid" in relation to those recommendations. (643 words) - [MedicinalProductUndesirableEffect | Medplum](/content/docs/api/fhir/resources/medicinalproductundesirableeffect/index.html): Describe the undesirable effects of the medicinal product. (403 words) - [MedicinalProductContraindication | Medplum](/content/docs/api/fhir/resources/medicinalproductcontraindication/index.html): The clinical particulars - indications, contraindications etc. of a medicinal product, including for regulatory purposes. (546 words) - [core.agentreloadconfigresponse | Medplum](/content/docs/sdk/core-agentreloadconfigresponse.html): Home > @medplum/core > AgentReloadConfigResponse (22 words) - [Communication | Medplum](/content/docs/api/fhir/resources/communication/index.html): An occurrence of information being transmitted; e.g. an alert that was sent to a responsible provider, a public health agency that was notified about a reportable condition. (1,454 words) - [core.agentmessage | Medplum](/content/docs/sdk/core-agentmessage.html): Home > @medplum/core > AgentMessage (13 words) - [core.agentreloadconfigrequest | Medplum](/content/docs/sdk/core-agentreloadconfigrequest.html): Home > @medplum/core > AgentReloadConfigRequest (20 words) - [core.agentlogsresponse | Medplum](/content/docs/sdk/core-agentlogsresponse.html): Home > @medplum/core > AgentLogsResponse (64 words) - [Linkage | Medplum](/content/docs/api/fhir/resources/linkage/index.html): Identifies two or more records (resource instances) that refer to the same real-world "occurrence". (904 words) - [core.agentreloadconfigresponse.statuscode | Medplum](/content/docs/sdk/core-agentreloadconfigresponse-statuscode.html): Home > @medplum/core > AgentReloadConfigResponse > statusCode (8 words) - [Patient $match | Medplum](/content/docs/api/fhir/operations/patient-match/index.html): The $match operation implements Master Patient Index (MPI) patient matching. It accepts a (possibly partial) Patient resource, searches your project for candidates, and returns a Bundle of matches — each annotated with a score and match grade. (1,550 words) - [MedicinalProductIngredient | Medplum](/content/docs/api/fhir/resources/medicinalproductingredient/index.html): An ingredient of a manufactured item or pharmaceutical product. (786 words) - [core.agentlogsresponse.nextbefore | Medplum](/content/docs/sdk/core-agentlogsresponse-nextbefore.html): Home > @medplum/core > AgentLogsResponse > nextBefore (29 words) - [core.agentlogsresponse.hasmore | Medplum](/content/docs/sdk/core-agentlogsresponse-hasmore.html): Home > @medplum/core > AgentLogsResponse > hasMore (20 words) - [DataRequirement | Medplum](/content/docs/api/fhir/datatypes/datarequirement/index.html): Base StructureDefinition for DataRequirement Type: Describes a required data item for evaluation in terms of the type of data, and optional code or date-based filters of the data. (1,599 words) - [core.agentlogsresponse.type | Medplum](/content/docs/sdk/core-agentlogsresponse-type.html): Home > @medplum/core > AgentLogsResponse > type (7 words) - [core.agentlogsresponse.statuscode | Medplum](/content/docs/sdk/core-agentlogsresponse-statuscode.html): Home > @medplum/core > AgentLogsResponse > statusCode (7 words) - [core.agentlogsrequest | Medplum](/content/docs/sdk/core-agentlogsrequest.html): Home > @medplum/core > AgentLogsRequest (78 words) - [core.agentlogsrequest.type | Medplum](/content/docs/sdk/core-agentlogsrequest-type.html): Home > @medplum/core > AgentLogsRequest > type (7 words) - [DocumentManifest | Medplum](/content/docs/api/fhir/resources/documentmanifest/index.html): A collection of documents compiled for a purpose together with metadata that applies to the collection. (1,173 words) - [MedicinalProductManufactured | Medplum](/content/docs/api/fhir/resources/medicinalproductmanufactured/index.html): The manufactured item as contained in the packaged medicinal product. (578 words) - [Bundle | Medplum](/content/docs/api/fhir/resources/bundle/index.html): A container for a collection of resources. (1,475 words) - [MedicinalProductAuthorization | Medplum](/content/docs/api/fhir/resources/medicinalproductauthorization/index.html): The regulatory authorization of a medicinal product. (702 words) - [core.agentlogsrequest.limit | Medplum](/content/docs/sdk/core-agentlogsrequest-limit.html): Home > @medplum/core > AgentLogsRequest > limit (8 words) - [Resource $graph | Medplum](/content/docs/api/fhir/operations/resource-graph/index.html): The $graph operation fetches all resources related to a given resource as defined by a GraphDefinition. This allows you to retrieve a complete graph of related resources in a single request. (600 words) - [core.agentlogsrequest.before | Medplum](/content/docs/sdk/core-agentlogsrequest-before.html): Home > @medplum/core > AgentLogsRequest > before (49 words) - [DetectedIssue | Medplum](/content/docs/api/fhir/resources/detectedissue/index.html): Indicates an actual or potential clinical issue with or between one or more active or proposed clinical actions for a patient; e.g. Drug-drug interaction, Ineffective treatment frequency, Procedure-condition conflict, etc. (1,048 words) - [Projects | Medplum](/content/docs/access/projects/index.html): Medplum Projects are the primary mechanism of access control. Projects are isolated containers of FHIR resources that are administered separately, and which can have different settings. (1,501 words) - [core.agentheartbeatresponse.version | Medplum](/content/docs/sdk/core-agentheartbeatresponse-version.html): Home > @medplum/core > AgentHeartbeatResponse > version (7 words) - [Flag | Medplum](/content/docs/api/fhir/resources/flag/index.html): Prospective warnings of potential issues when providing care to the patient. (1,155 words) - [DeviceUseStatement | Medplum](/content/docs/api/fhir/resources/deviceusestatement/index.html): A record of a device being used by a patient where the record is the result of a report from the patient or another clinician. (838 words) - [CoverageEligibilityRequest | Medplum](/content/docs/api/fhir/resources/coverageeligibilityrequest/index.html): The CoverageEligibilityRequest provides patient and insurance coverage information to an insurer for them to respond, in the form of an CoverageEligibilityResponse, with information regarding whether the stated coverage is valid and in-force and optionally to provide the insurance details of the policy. (806 words) - [Project | Medplum](/content/docs/api/fhir/medplum/project/index.html): Encapsulation of resources for a specific project or organization. (1,014 words) - [core.agentheartbeatresponse.type | Medplum](/content/docs/sdk/core-agentheartbeatresponse-type.html): Home > @medplum/core > AgentHeartbeatResponse > type (7 words) - [Self-Hosting Best Practices | Medplum](/content/docs/self-hosting/best-practices/index.html): You've decided to self-host Medplum — great. This guide covers operational practices that will help you run a stable, maintainable deployment and set yourself up for long-term success. (1,174 words) - [ConceptMap $translate | Medplum](/content/docs/api/fhir/operations/conceptmap-translate/index.html): Code translation enables seamless data exchange between systems that speak different "clinical languages," ensuring that a diagnosis recorded in one system can be understood and processed correctly by another. (565 words) - [GraphDefinition | Medplum](/content/docs/api/fhir/resources/graphdefinition/index.html): A formal computable definition of a graph of resources - that is, a coherent set of resources that form a graph by following references. The Graph Definition resource defines a set and makes rules about the set. (570 words) - [Bot $execute | Medplum](/content/docs/api/fhir/operations/bot-execute/index.html): The $execute operation runs a Medplum Bot on-demand, allowing you to trigger server-side automation logic via API calls. Bots can process (811 words) - [EpisodeOfCare | Medplum](/content/docs/api/fhir/resources/episodeofcare/index.html): An association between a patient and an organization / healthcare provider(s) during which time encounters may occur. The managing organization assumes a level of responsibility for the patient during this time. (440 words) - [Signature | Medplum](/content/docs/api/fhir/datatypes/signature/index.html): Base StructureDefinition for Signature Type: A signature along with supporting context. The signature may be a digital signature that is cryptographic in nature, or some other signature acceptable to the domain. This other signature may be as simple as a graphical image representing a hand-written signature, or a signature ceremony Different signature approaches have different utilities. (421 words) - [Endpoint | Medplum](/content/docs/api/fhir/resources/endpoint/index.html): The technical details of an endpoint that can be used for electronic services, such as for web services providing XDS.b or a REST endpoint for another FHIR server. This may include any security context information. (2,004 words) - [Agent | Medplum](/content/docs/api/fhir/medplum/agent/index.html): Configuration details for an instance of the Medplum agent application. (598 words) - [ClientApplication $smart-launch | Medplum](/content/docs/api/fhir/operations/clientapplication-smart-launch/index.html): The $smart-launch operation initiates a SMART on FHIR app launch sequence for a ClientApplication. This creates a SmartAppLaunch context resource and redirects the user to the application's launch URI. (352 words) - [Attachment | Medplum](/content/docs/api/fhir/datatypes/attachment/index.html): Base StructureDefinition for Attachment Type: For referring to data content defined in other formats. (509 words) - [JsonWebKey | Medplum](/content/docs/api/fhir/medplum/jsonwebkey/index.html): A JSON object that represents a cryptographic key. The members of the object represent properties of the key, including its value. (688 words) - [GraphQL | Medplum](/content/docs/api/fhir/operations/graphql/index.html): The FHIR GraphQL API allows you to query and retrieve FHIR resources using GraphQL syntax, enabling precise data fetching with a single request. Unlike traditional REST endpoints that return fixed resource structures, GraphQL lets clients specify exactly which fields and related resources they need, reducing over-fetching and minimizing network round trips. (157 words) - [PlanDefinition $apply | Medplum](/content/docs/api/fhir/operations/plandefinition-apply/index.html): Medplum implements the FHIR $apply operation for PlanDefinition resources. (414 words) - [Using Agent Search Parameters in Bulk Operations | Medplum](/content/docs/agent/using-search-parameters/index.html): Several of the Medplum Agent operations can act on more than one agent at a time. Instead of targeting a single agent by ID, you invoke the operation against the Agent type endpoint and use Agent search parameters to select which agents the operation should run against. (536 words) - [Custom FHIR Operations | Medplum](/content/docs/bots/custom-fhir-operations/index.html): Custom FHIR Operations is a powerful feature that allows you to extend the Medplum FHIR server with your own custom operations using the Medplum Bots framework. This feature enables you to create sophisticated business logic that integrates seamlessly with the FHIR API while leveraging the full power of JavaScript execution. (724 words) - [External Identity Providers | Medplum](/content/docs/auth/external-identity-providers/index.html): Along with Google Authentication, Medplum supports other external identity providers using the OAuth2 protocol such as Auth0 and AWS Cognito for end user authentication. This is sometimes known as "Federated Identities". (678 words) - [Overview | Medplum](/content/docs/api/fhir/index.html): Medplum is based on the FHIR API. (49 words) - [Multi-Factor Authentication (MFA) | Medplum](/content/docs/auth/mfa/index.html): Multi-Factor Authentication (MFA) adds an extra layer of security to user accounts by requiring a second authentication factor beyond a password. Medplum supports two MFA methods: (542 words) - [Patient $summary | Medplum](/content/docs/api/fhir/operations/patient-summary/index.html): The $summary operation generates an International Patient Summary (IPS) document for a patient. This creates a comprehensive clinical summary following the IPS Implementation Guide. (525 words) - [Measure $evaluate-measure | Medplum](/content/docs/api/fhir/operations/evaluate-measure/index.html): The $evaluate-measure operation executes a defined clinical quality measure against your patient population and returns aggregated results. This enables healthcare organizations to programmatically calculate quality metrics, track clinical outcomes, and generate reports for regulatory compliance without manual data extraction. (257 words) - [Contract | Medplum](/content/docs/api/fhir/resources/contract/index.html): Legally enforceable, formally recorded unilateral or bilateral directive i.e., a policy or agreement. (11,103 words) - [EnrollmentRequest | Medplum](/content/docs/api/fhir/resources/enrollmentrequest/index.html): This resource provides the insurance enrollment details to the insurer regarding a specified coverage. (548 words) - [AWS Textract/Comprehend | Medplum](/content/docs/ai/aws/index.html): This documentation explains how Medplum integrates with AWS Textract for optical character recognition (OCR) and AWS Comprehend Medical for extracting clinical entities from text. This powerful combination allows developers to process and analyze unstructured medical documents, such as scanned PDFs or images, directly within their Medplum projects. (928 words) - [13 docs tagged with "communications" | Medplum](/content/docs/tags/communications/index.html) (507 words) - [Agent Access Policy | Medplum](/content/docs/agent/access-policy/index.html): This guide covers the minimal access policy configuration required for the Medplum Agent, including how to use parameterized policies for multi-organization deployments. (550 words) - [FHIR Data Types | Medplum](/content/docs/api/fhir/datatypes/index.html): FHIR Data Type Reference (1,095 words) - [Bot $deploy | Medplum](/content/docs/api/fhir/operations/bot-deploy/index.html): The $deploy operation uploads and activates Bot code on the Medplum server. This is essential for making your automation logic available for (341 words) - [Coding | Medplum](/content/docs/api/fhir/datatypes/coding/index.html): Base StructureDefinition for Coding Type: A reference to a code defined by a terminology system. (482 words) - [Basic | Medplum](/content/docs/api/fhir/resources/basic/index.html): Basic is used for handling concepts not yet defined in FHIR, narrative-only resources that don't map to an existing resource, and custom resources not appropriate for inclusion in the FHIR specification. (927 words) - [Claim $export | Medplum](/content/docs/api/fhir/operations/claim-export/index.html): The $export operation exports a Claim resource as a CMS-1500 PDF document. This is useful for generating standardized claim forms for healthcare billing. (348 words) - [User $rescope | Medplum](/content/docs/api/fhir/operations/user-rescope/index.html): The $rescope operation moves a User between server scope (not owned by any Project) and project scope (owned by a specific Project). This controls which Project the User resource itself belongs to — it is distinct from a ProjectMembership, which controls access. (627 words) - [Questionnaires | Medplum](/content/products/questionnaires/index.html): Get data from patients, clinicians, staff and other stakeholders using custom forms. Forms go by many names, questionnaires, surveys, ePRO, and more, but they have the same function: to collect data from a user in a standard way. (266 words) - [Medplum](/content/app/register/index.html): Medplum: Medical Collaboration (31 words) - [core.propertytype | Medplum](/content/docs/sdk/core-propertytype.html): Home > @medplum/core > PropertyType (213 words) - [Account Executive | Medplum](/content/careers/account-executive/index.html): Account Executive (662 words) - [Automation through Bots | Medplum](/content/products/bots/index.html): Automation, and the ability to build highly automated, custom workflows is one of the primary use-cases of Medplum. Medplum automations are implemented via bots, which are lambdas that implement custom functions written by developers. (396 words) - [Uploading Files | Medplum](/content/docs/bots/file-uploads/index.html): In digital health, a common requirement is to upload PDFs or other files from one system to another. Examples include: (515 words) - [User $update-email | Medplum](/content/docs/api/fhir/operations/user-update-email/index.html): This operation updates both the User resource (for authentication) and optionally the associated profile resource (Patient, Practitioner, or RelatedPerson) with the new email address. (423 words) - [BulkDataExport | Medplum](/content/docs/api/fhir/medplum/bulkdataexport/index.html): User specific configuration for the Medplum application. (662 words) - [Terminologies and Coded Values | Medplum](/content/docs/terminology/index.html): Many FHIR resources use different types of coded values to unambiguously represent different concepts from healthcare (611 words) - [Tags | Medplum](/content/blog/tags/index.html) (58 words) - [core.currentcontext | Medplum](/content/docs/sdk/core-currentcontext.html): Home > @medplum/core > CurrentContext (72 words) - [CodeSystem $import | Medplum](/content/docs/api/fhir/operations/codesystem-import/index.html): Large standard terminologies like SNOMED CT (423 words) - [Forward Deployed Engineer | Medplum](/content/careers/forward-deployed-engineer/index.html): Forward Deployed Engineer (772 words) - [Ratio | Medplum](/content/docs/api/fhir/datatypes/ratio/index.html): Base StructureDefinition for Ratio Type: A relationship of two Quantity values - expressed as a numerator and a denominator. (194 words) - [ConceptMap $import | Medplum](/content/docs/api/fhir/operations/conceptmap-import/index.html): The $import operation allows you to import code mappings into a ConceptMap. This is useful for bulk loading terminology mappings from external sources or programmatically adding mappings to an existing ConceptMap. (505 words) - [core.stringifytypedvalue | Medplum](/content/docs/sdk/core-stringifytypedvalue.html): Home > @medplum/core > stringifyTypedValue (52 words) - [Binary | Medplum](/content/docs/api/fhir/resources/binary/index.html): A resource that represents the data of a single raw artifact as digital content accessible in its native format. A Binary resource can contain any content, whether text, image, pdf, zip archive, etc. (551 words) - [Upgrade RDS Database | Medplum](/content/docs/self-hosting/upgrade-rds-database/index.html): As your project grows, you may need to upgrade your RDS database instance size. This document describes how to perform this operation with zero downtime. (415 words) - [Resource $resend | Medplum](/content/docs/api/fhir/operations/resend/index.html): The $resend operation manually triggers subscription notifications for a specific resource. This is invaluable for debugging subscription workflows, recovering from failed notifications, and replaying events during development or after system issues. (318 words) - [core.operationoutcomeerror._constructor_ | Medplum](/content/docs/sdk/core-operationoutcomeerror-_constructor_.html): Home > @medplum/core > OperationOutcomeError > (constructor) (25 words) - [One post tagged with "customers" | Medplum](/content/blog/tags/customers/index.html) (163 words) - [18 posts tagged with "self-host" | Medplum](/content/blog/tags/self-host/index.html) (693 words) - [SampledData | Medplum](/content/docs/api/fhir/datatypes/sampleddata/index.html): Base StructureDefinition for SampledData Type: A series of measurements taken by a device, with upper and lower limits. There may be more than one dimension in the data. (392 words) - [Count | Medplum](/content/docs/api/fhir/datatypes/count/index.html): Base StructureDefinition for Count Type: A measured amount (or an amount that can potentially be measured). Note that measured amounts include amounts that are not precisely quantified, including amounts involving arbitrary units and floating currencies. (375 words) - [core.fhirpatharrayequals | Medplum](/content/docs/sdk/core-fhirpatharrayequals.html): Home > @medplum/core > fhirPathArrayEquals (43 words) - [Install on DigitalOcean | Medplum](/content/docs/self-hosting/install-on-digital-ocean/index.html): This guide covers the DigitalOcean-specific steps for running the Medplum API server. For production deployments, use DigitalOcean Managed PostgreSQL and Managed Redis rather than running databases inside the application container. (396 words) - [Using Medplum as IDP | Medplum](/content/docs/auth/medplum-as-idp/index.html): Introduction (355 words) - [core.isdatatypeloaded | Medplum](/content/docs/sdk/core-isdatatypeloaded.html): Home > @medplum/core > isDataTypeLoaded (20 words) - [core.medplumrequestoptions.duplex | Medplum](/content/docs/sdk/core-medplumrequestoptions-duplex.html): Home > @medplum/core > MedplumRequestOptions > duplex (13 words) - [core.tokenresponse.access_token | Medplum](/content/docs/sdk/core-tokenresponse-access_token.html): Home > @medplum/core > TokenResponse > access\token (8 words) - [core.subscriptionmanager.closewebsocket | Medplum](/content/docs/sdk/core-subscriptionmanager-closewebsocket.html): Home > @medplum/core > SubscriptionManager > closeWebSocket (10 words) - [core.crawltypedvalueasync | Medplum](/content/docs/sdk/core-crawltypedvalueasync.html): Home > @medplum/core > crawlTypedValueAsync (57 words) - [23 posts tagged with "community" | Medplum](/content/blog/tags/community/page/2/index.html) (671 words) - [core.tokenscontext.caseinsensitive | Medplum](/content/docs/sdk/core-tokenscontext-caseinsensitive.html): Home > @medplum/core > TokensContext > caseInsensitive (7 words) - [Refresh Reference Display Strings | Medplum](/content/docs/api/fhir/operations/refresh-reference-display/index.html): The $refresh-reference-display operation updates the Reference.display strings within a resource to reflect the (84 words) - [One post tagged with "press" | Medplum](/content/blog/tags/press/index.html) (18 words) - [One post tagged with "communications" | Medplum](/content/blog/tags/communications/index.html) (79 words) - [System Requirements | Medplum](/content/docs/agent/requirements/index.html): Medplum publishes an official agent installer for Microsoft Windows. (309 words) - [core.sortrule.code | Medplum](/content/docs/sdk/core-sortrule-code.html): Home > @medplum/core > SortRule > code (13 words) - [assets/files/medplum-security-public-9ea289ac4be9b7698b83c9c77d0c4169-asc.html](/content/assets/files/medplum-security-public-9ea289ac4be9b7698b83c9c77d0c4169-asc.html) (21 words) - [core.addressformatoptions | Medplum](/content/docs/sdk/core-addressformatoptions.html): Home > @medplum/core > AddressFormatOptions (23 words) - [core.evalfhirpath | Medplum](/content/docs/sdk/core-evalfhirpath.html): Home > @medplum/core > evalFhirPath (94 words) - [Set Password Endpoint | Medplum](/content/docs/api/auth/setpassword/index.html): POST /auth/setpassword (165 words) - [One doc tagged with "medication" | Medplum](/content/docs/tags/medication/index.html) (42 words) - [core.medicationorderrequest.durationdays | Medplum](/content/docs/sdk/core-medicationorderrequest-durationdays.html): Home > @medplum/core > MedicationOrderRequest > durationDays (23 words) - [Send SMTP Emails with SendGrid | Medplum](/content/docs/self-hosting/sendgrid/index.html): This page describes how to use SendGrid as an SMTP Relay to send emails from Medplum. (208 words) - [One post tagged with "news" | Medplum](/content/blog/tags/news/index.html) (422 words) - [External Lambda Functions | Medplum](/content/docs/bots/external-function/index.html): When running Medplum in AWS, Medplum uses AWS Lambdas to execute bot logic. (248 words) - [One doc tagged with "questionnaires" | Medplum](/content/docs/tags/questionnaires/index.html) (44 words) - [core.readhistoryoptions | Medplum](/content/docs/sdk/core-readhistoryoptions.html): Home > @medplum/core > ReadHistoryOptions (22 words) - [2 docs tagged with "self-hosting" | Medplum](/content/docs/tags/self-hosting/index.html) (60 words) - [core.inviterequest.membership | Medplum](/content/docs/sdk/core-inviterequest-membership.html): Home > @medplum/core > InviteRequest > membership (7 words) - [One doc tagged with "provider" | Medplum](/content/docs/tags/provider/index.html) (54 words) - [core.extensible.extension | Medplum](/content/docs/sdk/core-extensible-extension.html): Home > @medplum/core > Extensible > extension (7 words) - [One doc tagged with "insurance" | Medplum](/content/docs/tags/insurance/index.html) (275 words) - [core.multiplematches | Medplum](/content/docs/sdk/core-multiplematches.html): Home > @medplum/core > multipleMatches (7 words) - [core.tokenizeroptions.symbolregex | Medplum](/content/docs/sdk/core-tokenizeroptions-symbolregex.html): Home > @medplum/core > TokenizerOptions > symbolRegex (8 words) - [core.medicationorderdruginput.rxnorm | Medplum](/content/docs/sdk/core-medicationorderdruginput-rxnorm.html): Home > @medplum/core > MedicationOrderDrugInput > rxNorm (8 words) - [One post tagged with "questionnaires" | Medplum](/content/blog/tags/questionnaires/index.html) (89 words) - [core.clearscheduleparameter | Medplum](/content/docs/sdk/core-clearscheduleparameter.html): Home > @medplum/core > clearScheduleParameter (78 words) - [10 posts tagged with "case-study" | Medplum](/content/blog/tags/case-study/index.html) (166 words) - [core.assert_2 | Medplum](/content/docs/sdk/core-assert_2.html): Home > @medplum/core > assert\2 (33 words) - [One doc tagged with "scheduling" | Medplum](/content/docs/tags/scheduling/index.html) (60 words) - [core.fhirfiltercomparison.value | Medplum](/content/docs/sdk/core-fhirfiltercomparison-value.html): Home > @medplum/core > FhirFilterComparison > value (7 words) - [One post tagged with "radiology" | Medplum](/content/blog/tags/radiology/index.html) (49 words) - [core.errorevent_2 | Medplum](/content/docs/sdk/core-errorevent_2.html): Home > @medplum/core > ErrorEvent\2 (19 words) - [core.hl7message.getallsegments | Medplum](/content/docs/sdk/core-hl7message-getallsegments.html): Home > @medplum/core > Hl7Message > getAllSegments (63 words) - [core.medicationorderdruginput.quantity | Medplum](/content/docs/sdk/core-medicationorderdruginput-quantity.html): Home > @medplum/core > MedicationOrderDrugInput > quantity (8 words) - [core.newpatientrequest.login | Medplum](/content/docs/sdk/core-newpatientrequest-login.html): Home > @medplum/core > NewPatientRequest > login (14 words) - [core.ismedicationcartmanageresponse | Medplum](/content/docs/sdk/core-ismedicationcartmanageresponse.html): Home > @medplum/core > isMedicationCartManageResponse (38 words) - [core.medpluminfraconfig.cloudtrailalarms | Medplum](/content/docs/sdk/core-medpluminfraconfig-cloudtrailalarms.html): Home > @medplum/core > MedplumInfraConfig > cloudTrailAlarms (15 words) - [core.typedvalue.value | Medplum](/content/docs/sdk/core-typedvalue-value.html): Home > @medplum/core > TypedValue > value (8 words) - [Medplum](/content/app/batch/index.html): Medplum: Medical Collaboration (40 words) - [Including Linked Resources | Medplum](/content/docs/search/includes/index.html): In many cases, your application may need to search for not just one resource type, but also some of the related (864 words) - [Basic Search | Medplum](/content/docs/search/basic-search/index.html): Intro (1,549 words) - [core.medplumsourceinfraconfig | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig.html): Home > @medplum/core > MedplumSourceInfraConfig (441 words) - [Publish and Subscribe | Medplum](/content/docs/subscriptions/publish-and-subscribe/index.html): In a healthcare setting, Publish and Subscribe is a common pattern. For example, an everyday workflow in a laboratory setting is for a physician to create a lab order for a patient, and then receive a finalized lab report once the sample has been collected from the patient and processed. (1,399 words) - [Subscription Extensions | Medplum](/content/docs/subscriptions/subscription-extensions/index.html): Use the following FHIR extensions to customize the Subscription behavior. The behavior is non-standard, and will not necessarily work in other FHIR systems. (1,067 words) - [Paginated Search | Medplum](/content/docs/search/paginated-search/index.html): Pagination is a crucial feature in any API that deals with large datasets, and our FHIR API is no exception. When querying resources, it's often impractical or unnecessary to return all matching results in a single response. Pagination allows clients to retrieve results in manageable chunks, improving performance and reducing network load. (1,496 words) - [Custom Emails | Medplum](/content/docs/user-management/custom-emails/index.html): Some server actions send email messages to users. For example, when a user creates a new account, the server sends a "Welcome" email message. On Medplum's hosted environment, the email will include a link to "https://app.medplum.com/setpassword/...". (872 words) - [Browse Sample Data | Medplum](/content/docs/tutorials/browse-sample-data/index.html): The dataset provided demonstrates how to represent many common data types. Once the data has been imported you can browse it in the Medplum app. Click the links in the middle column to browse some of the data. (215 words) - [core.reconnectingwebsocket | Medplum](/content/docs/sdk/core-reconnectingwebsocket.html): Home > @medplum/core > ReconnectingWebSocket (242 words) - [Enabling Rollbacks for Medplum Server | Medplum](/content/docs/self-hosting/enabling-rollbacks/index.html): As of the 4.x series, Medplum supports a safe and well-defined rollback window for server deployments, provided you control when post-deploy migrations run. (949 words) - [Chaining Searches | Medplum](/content/docs/search/chained-search/index.html): Chaining search parameters allows you to filter your searches based on the parameters of another resource which is related to the target resource through one or more references. This can reduce what might otherwise be a series of searches into just a single action. (733 words) - [Medplum Terminology Services | Medplum](/content/docs/terminology/medplum-terminology-services/index.html): Medplum provides a layer of functionality to make working with coded values simple. Some of the most common use cases (708 words) - [Update RDS Parameters | Medplum](/content/docs/self-hosting/rds-parameters/index.html): Postgres exposes a wide variety of configuration settings that can be tuned to improve database performance. These (729 words) - [Register an Account | Medplum](/content/docs/tutorials/register/index.html): This guide explains how to register for a new Medplum account and create your first Medplum project. (430 words) - [Commonly Used Terminologies | Medplum](/content/docs/terminology/common-terminologies/index.html): This guide provides a comprehensive reference for the most commonly used code systems and ValueSets in healthcare applications. Each section includes the FHIR system URLs needed for proper coding in FHIR resources. (495 words) - [Super Admin CLI | Medplum](/content/docs/self-hosting/super-admin-cli/index.html): Medplum includes a CLI (Command Line Interface). (601 words) - [Project vs Server Scoped Users | Medplum](/content/docs/user-management/project-vs-server-scoped-users/index.html): Server Scoped Users (511 words) - [Local Codes | Medplum](/content/docs/terminology/local-codes/index.html): In addition to widely-used code systems like LOINC, FHIR makes it possible to define and use (484 words) - [Medplum Hello World | Medplum](/content/docs/tutorials/medplum-hello-world/index.html): Digital health companies often build custom UIs on top of the Medplum platform to design streamlined patient and physician experiences. This tutorial will cover how to run the Medplum "Hello World" example, a simple React app that visualizes patient information. (521 words) - [Project SMTP | Medplum](/content/docs/user-management/project-smtp/index.html): By default, all emails sent on behalf of your project use the Medplum server's email provider and sender address. Projects can instead send email through their own SMTP relay (such as SendGrid, Mailgun, or Amazon SES SMTP) so that emails arrive from your own domain. (454 words) - [Import Sample Data | Medplum](/content/docs/tutorials/importing-sample-data/index.html): When starting development, it can be really useful to have some sample data to work with, and to test your application. This tutorial will walk you through importing sample FHIR data into your Medplum project to aid in building a realistic application. (355 words) - [GIN Index Performance | Medplum](/content/docs/self-hosting/gin-index-performance/index.html): The operations described in this guide require super admin privileges and are only available to self-hosted deployments. (417 words) - [Server-Scoped Subscriptions | Medplum](/content/docs/subscriptions/server-scoped-subscriptions/index.html): A server-scoped Subscription fires for rest-hook changes across every project on the server, not just its own project. It's useful for project-per-tenant deployments that need one central, server-wide data-processing flow. (179 words) - [Using External IDs | Medplum](/content/docs/user-management/external-ids/index.html): By default, Medplum uses email address as a unique identifier for a user. When using External Identity Providers, you may instead want to use the external ID rather than email. This document describes the additional changes to use external ID. (149 words) - [core.xoratom | Medplum](/content/docs/sdk/core-xoratom.html): Home > @medplum/core > XorAtom (67 words) - [core.resourcemodifiedevent | Medplum](/content/docs/sdk/core-resourcemodifiedevent.html): Home > @medplum/core > ResourceModifiedEvent (132 words) - [core.servicetypeincludesservice | Medplum](/content/docs/sdk/core-servicetypeincludesservice.html): Home > @medplum/core > serviceTypeIncludesService (71 words) - [core.singularize | Medplum](/content/docs/sdk/core-singularize.html): Home > @medplum/core > singularize (34 words) - [core.slicedefinition | Medplum](/content/docs/sdk/core-slicedefinition.html): Home > @medplum/core > SliceDefinition (41 words) - [core.submanageroptions.reconnectingwebsocket | Medplum](/content/docs/sdk/core-submanageroptions-reconnectingwebsocket.html): Home > @medplum/core > SubManagerOptions > ReconnectingWebSocket (7 words) - [core.validationregexes | Medplum](/content/docs/sdk/core-validationregexes.html): Home > @medplum/core > validationRegexes (8 words) - [core.slicingrules | Medplum](/content/docs/sdk/core-slicingrules.html): Home > @medplum/core > SlicingRules (27 words) - [core.wordwrap | Medplum](/content/docs/sdk/core-wordwrap.html): Home > @medplum/core > wordWrap (42 words) - [core.structuremaptransform | Medplum](/content/docs/sdk/core-structuremaptransform.html): Home > @medplum/core > structureMapTransform (57 words) - [core.typeinfo | Medplum](/content/docs/sdk/core-typeinfo.html): Home > @medplum/core > TypeInfo (44 words) - [core.valuesetexpandparams.offset | Medplum](/content/docs/sdk/core-valuesetexpandparams-offset.html): Home > @medplum/core > ValueSetExpandParams > offset (8 words) - [core.sleepoptions | Medplum](/content/docs/sdk/core-sleepoptions.html): Home > @medplum/core > SleepOptions (30 words) - [core.slicingrules.discriminator | Medplum](/content/docs/sdk/core-slicingrules-discriminator.html): Home > @medplum/core > SlicingRules > discriminator (8 words) - [core.slicingrules.rule | Medplum](/content/docs/sdk/core-slicingrules-rule.html): Home > @medplum/core > SlicingRules > rule (12 words) - [core.selectionstructure | Medplum](/content/docs/sdk/core-selectionstructure.html): Home > @medplum/core > SelectionStructure (66 words) - [core.withid | Medplum](/content/docs/sdk/core-withid.html): Home > @medplum/core > WithId (21 words) - [core.valuesetexpandparams.url | Medplum](/content/docs/sdk/core-valuesetexpandparams-url.html): Home > @medplum/core > ValueSetExpandParams > url (8 words) - [core.searchrequest | Medplum](/content/docs/sdk/core-searchrequest.html): Home > @medplum/core > SearchRequest (71 words) - [core.subscriptionemitter.getcriteria | Medplum](/content/docs/sdk/core-subscriptionemitter-getcriteria.html): Home > @medplum/core > SubscriptionEmitter > getCriteria (10 words) - [core.warnifnewerversionavailable | Medplum](/content/docs/sdk/core-warnifnewerversionavailable.html): Home > @medplum/core > warnIfNewerVersionAvailable (63 words) - [core.typeinfo.searchparams | Medplum](/content/docs/sdk/core-typeinfo-searchparams.html): Home > @medplum/core > TypeInfo > searchParams (9 words) - [core.typedeventtarget.removealllisteners | Medplum](/content/docs/sdk/core-typedeventtarget-removealllisteners.html): Home > @medplum/core > TypedEventTarget > removeAllListeners (10 words) - [core.servertimeout | Medplum](/content/docs/sdk/core-servertimeout.html): Home > @medplum/core > serverTimeout (21 words) - [core.singleton | Medplum](/content/docs/sdk/core-singleton.html): Home > @medplum/core > singleton (29 words) - [core.submanageroptions.debuglogger | Medplum](/content/docs/sdk/core-submanageroptions-debuglogger.html): Home > @medplum/core > SubManagerOptions > debugLogger (10 words) - [core.setcodebysystem | Medplum](/content/docs/sdk/core-setcodebysystem.html): Home > @medplum/core > setCodeBySystem (49 words) - [core.testerror | Medplum](/content/docs/sdk/core-testerror.html): Home > @medplum/core > TestError (38 words) - [core.slicedefinition.definition | Medplum](/content/docs/sdk/core-slicedefinition-definition.html): Home > @medplum/core > SliceDefinition > definition (13 words) - [core.searchparameterdetails.array | Medplum](/content/docs/sdk/core-searchparameterdetails-array.html): Home > @medplum/core > SearchParameterDetails > array (9 words) - [core.testoperation.path | Medplum](/content/docs/sdk/core-testoperation-path.html): Home > @medplum/core > TestOperation > path (8 words) - [core.sleep | Medplum](/content/docs/sdk/core-sleep.html): Home > @medplum/core > sleep (45 words) - [core.slicediscriminator.type | Medplum](/content/docs/sdk/core-slicediscriminator-type.html): Home > @medplum/core > SliceDiscriminator > type (7 words) - [core.slicedefinition.elements | Medplum](/content/docs/sdk/core-slicedefinition-elements.html): Home > @medplum/core > SliceDefinition > elements (14 words) - [core.servererror | Medplum](/content/docs/sdk/core-servererror.html): Home > @medplum/core > serverError (26 words) - [core.slicediscriminator.path | Medplum](/content/docs/sdk/core-slicediscriminator-path.html): Home > @medplum/core > SliceDiscriminator > path (8 words) - [core.searchrequest.total | Medplum](/content/docs/sdk/core-searchrequest-total.html): Home > @medplum/core > SearchRequest > total (12 words) - [core.sleepoptions.signal | Medplum](/content/docs/sdk/core-sleepoptions-signal.html): Home > @medplum/core > SleepOptions > signal (22 words) - [core.slicingrules.ordered | Medplum](/content/docs/sdk/core-slicingrules-ordered.html): Home > @medplum/core > SlicingRules > ordered (8 words) - [core.xoratom.eval | Medplum](/content/docs/sdk/core-xoratom-eval.html): Home > @medplum/core > XorAtom > eval (21 words) - [core.typedvalue.type | Medplum](/content/docs/sdk/core-typedvalue-type.html): Home > @medplum/core > TypedValue > type (8 words) - [core.slicedefinition.name | Medplum](/content/docs/sdk/core-slicedefinition-name.html): Home > @medplum/core > SliceDefinition > name (7 words) - [core.serializeerror | Medplum](/content/docs/sdk/core-serializeerror.html): Home > @medplum/core > serializeError (66 words) - [core.setidentifieroptions.use | Medplum](/content/docs/sdk/core-setidentifieroptions-use.html): Home > @medplum/core > SetIdentifierOptions > use (17 words) - [core.subsetresource | Medplum](/content/docs/sdk/core-subsetresource.html): Home > @medplum/core > subsetResource (88 words) - [core.setscheduleparameter | Medplum](/content/docs/sdk/core-setscheduleparameter.html): Home > @medplum/core > setScheduleParameter (154 words) - [core.replacequeryvariables | Medplum](/content/docs/sdk/core-replacequeryvariables.html): Home > @medplum/core > replaceQueryVariables (196 words) - [core.searchparameterdetails | Medplum](/content/docs/sdk/core-searchparameterdetails.html): Home > @medplum/core > SearchParameterDetails (32 words) - [core.smarthealthlinkmanifestfile | Medplum](/content/docs/sdk/core-smarthealthlinkmanifestfile.html): Home > @medplum/core > SmartHealthLinkManifestFile (18 words) - [core.validatoroptions.collect | Medplum](/content/docs/sdk/core-validatoroptions-collect.html): Home > @medplum/core > ValidatorOptions > collect (17 words) - [core.setidentifier | Medplum](/content/docs/sdk/core-setidentifier.html): Home > @medplum/core > setIdentifier (122 words) - [core.subscriptionmanager.removecriteria | Medplum](/content/docs/sdk/core-subscriptionmanager-removecriteria.html): Home > @medplum/core > SubscriptionManager > removeCriteria (22 words) - [core.unionatom.eval | Medplum](/content/docs/sdk/core-unionatom-eval.html): Home > @medplum/core > UnionAtom > eval (18 words) - [core.servicetypereferenceuri | Medplum](/content/docs/sdk/core-servicetypereferenceuri.html): Home > @medplum/core > ServiceTypeReferenceURI (69 words) - [core.smarthealthlinkpayload.flag | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-flag.html): Home > @medplum/core > SmartHealthLinkPayload > flag (8 words) - [core.slicedefinitionwithtypes | Medplum](/content/docs/sdk/core-slicedefinitionwithtypes.html): Home > @medplum/core > SliceDefinitionWithTypes (20 words) - [core.smarthealthlinkmanifestfile.contenttype | Medplum](/content/docs/sdk/core-smarthealthlinkmanifestfile-contenttype.html): Home > @medplum/core > SmartHealthLinkManifestFile > contentType (7 words) - [core.sortrule.descending | Medplum](/content/docs/sdk/core-sortrule-descending.html): Home > @medplum/core > SortRule > descending (8 words) - [core.selectionstructure.foreachornull | Medplum](/content/docs/sdk/core-selectionstructure-foreachornull.html): Home > @medplum/core > SelectionStructure > forEachOrNull (8 words) - [core.tokenresponse.refresh_token | Medplum](/content/docs/sdk/core-tokenresponse-refresh_token.html): Home > @medplum/core > TokenResponse > refresh\token (8 words) - [core.transformmapcollection.resources | Medplum](/content/docs/sdk/core-transformmapcollection-resources.html): Home > @medplum/core > TransformMapCollection > resources (16 words) - [core.tokenizeroptions.datetimeliterals | Medplum](/content/docs/sdk/core-tokenizeroptions-datetimeliterals.html): Home > @medplum/core > TokenizerOptions > dateTimeLiterals (7 words) - [core.smarthealthlinkmanifestfile.embedded | Medplum](/content/docs/sdk/core-smarthealthlinkmanifestfile-embedded.html): Home > @medplum/core > SmartHealthLinkManifestFile > embedded (8 words) - [core.testerror.actual | Medplum](/content/docs/sdk/core-testerror-actual.html): Home > @medplum/core > TestError > actual (7 words) - [core.token.id | Medplum](/content/docs/sdk/core-token-id.html): Home > @medplum/core > Token > id (7 words) - [core.slicingrules.slices | Medplum](/content/docs/sdk/core-slicingrules-slices.html): Home > @medplum/core > SlicingRules > slices (7 words) - [core.smarthealthlinkmanifestfile.lastupdated | Medplum](/content/docs/sdk/core-smarthealthlinkmanifestfile-lastupdated.html): Home > @medplum/core > SmartHealthLinkManifestFile > lastUpdated (7 words) - [core.rxnorm | Medplum](/content/docs/sdk/core-rxnorm.html): Home > @medplum/core > RXNORM (8 words) - [core.searchrequest.types | Medplum](/content/docs/sdk/core-searchrequest-types.html): Home > @medplum/core > SearchRequest > types (13 words) - [core.setidentifieroptions | Medplum](/content/docs/sdk/core-setidentifieroptions.html): Home > @medplum/core > SetIdentifierOptions (21 words) - [core.replace | Medplum](/content/docs/sdk/core-replace.html): Home > @medplum/core > replace (124 words) - [core.slicediscriminator | Medplum](/content/docs/sdk/core-slicediscriminator.html): Home > @medplum/core > SliceDiscriminator (15 words) - [core.smarthealthlinkmode | Medplum](/content/docs/sdk/core-smarthealthlinkmode.html): Home > @medplum/core > SmartHealthLinkMode (12 words) - [core.searchrequest.sortrules | Medplum](/content/docs/sdk/core-searchrequest-sortrules.html): Home > @medplum/core > SearchRequest > sortRules (8 words) - [core.samplinginfo | Medplum](/content/docs/sdk/core-samplinginfo.html): Home > @medplum/core > SamplingInfo (17 words) - [core.selectionstructure.unionall | Medplum](/content/docs/sdk/core-selectionstructure-unionall.html): Home > @medplum/core > SelectionStructure > unionAll (13 words) - [core.searchparametertype | Medplum](/content/docs/sdk/core-searchparametertype.html): Home > @medplum/core > SearchParameterType (39 words) - [core.remove | Medplum](/content/docs/sdk/core-remove.html): Home > @medplum/core > remove (75 words) - [core.selectionstructure.select | Medplum](/content/docs/sdk/core-selectionstructure-select.html): Home > @medplum/core > SelectionStructure > select (7 words) - [core.medpluminfraconfig | Medplum](/content/docs/sdk/core-medpluminfraconfig.html): Home > @medplum/core > MedplumInfraConfig (380 words) - [core.selectionstructure.column | Medplum](/content/docs/sdk/core-selectionstructure-column.html): Home > @medplum/core > SelectionStructure > column (8 words) - [core.searchrequest.name | Medplum](/content/docs/sdk/core-searchrequest-name.html): Home > @medplum/core > SearchRequest > name (13 words) - [core.searchrequest.summary | Medplum](/content/docs/sdk/core-searchrequest-summary.html): Home > @medplum/core > SearchRequest > summary (17 words) - [core.selectionstructure.foreach | Medplum](/content/docs/sdk/core-selectionstructure-foreach.html): Home > @medplum/core > SelectionStructure > forEach (8 words) - [core.searchrequest.offset | Medplum](/content/docs/sdk/core-searchrequest-offset.html): Home > @medplum/core > SearchRequest > offset (13 words) - [core.searchrequest.count | Medplum](/content/docs/sdk/core-searchrequest-count.html): Home > @medplum/core > SearchRequest > count (8 words) - [core.searchrequest.include | Medplum](/content/docs/sdk/core-searchrequest-include.html): Home > @medplum/core > SearchRequest > include (13 words) - [core.resolvesmarthealthlinkparams | Medplum](/content/docs/sdk/core-resolvesmarthealthlinkparams.html): Home > @medplum/core > ResolveSmartHealthLinkParams (23 words) - [core.searchrequest.pretty | Medplum](/content/docs/sdk/core-searchrequest-pretty.html): Home > @medplum/core > SearchRequest > pretty (5 words) - [core.searchrequest.revinclude | Medplum](/content/docs/sdk/core-searchrequest-revinclude.html): Home > @medplum/core > SearchRequest > revInclude (7 words) - [core.searchrequest.resourcetype | Medplum](/content/docs/sdk/core-searchrequest-resourcetype.html): Home > @medplum/core > SearchRequest > resourceType (8 words) - [core.searchparameterdetails.referencetargettypes | Medplum](/content/docs/sdk/core-searchparameterdetails-referencetargettypes.html): Home > @medplum/core > SearchParameterDetails > referenceTargetTypes (9 words) - [core.searchabletoken | Medplum](/content/docs/sdk/core-searchabletoken.html): Home > @medplum/core > SearchableToken (24 words) - [core.searchparameterdetails.parsedexpression | Medplum](/content/docs/sdk/core-searchparameterdetails-parsedexpression.html): Home > @medplum/core > SearchParameterDetails > parsedExpression (14 words) - [core.searchparameterdetails.elementdefinitions | Medplum](/content/docs/sdk/core-searchparameterdetails-elementdefinitions.html): Home > @medplum/core > SearchParameterDetails > elementDefinitions (9 words) - [core.requestprofileschemaoptions | Medplum](/content/docs/sdk/core-requestprofileschemaoptions.html): Home > @medplum/core > RequestProfileSchemaOptions (30 words) - [core.searchrequest.filters | Medplum](/content/docs/sdk/core-searchrequest-filters.html): Home > @medplum/core > SearchRequest > filters (7 words) - [core.searchrequest.cursor | Medplum](/content/docs/sdk/core-searchrequest-cursor.html): Home > @medplum/core > SearchRequest > cursor (13 words) - [core.reconnectingwebsocket.close | Medplum](/content/docs/sdk/core-reconnectingwebsocket-close.html): Home > @medplum/core > ReconnectingWebSocket > close (63 words) - [core.replaceoperation | Medplum](/content/docs/sdk/core-replaceoperation.html): Home > @medplum/core > ReplaceOperation (20 words) - [core.searchrequest.format | Medplum](/content/docs/sdk/core-searchrequest-format.html): Home > @medplum/core > SearchRequest > format (7 words) - [core.searchparameterdetails.type | Medplum](/content/docs/sdk/core-searchparameterdetails-type.html): Home > @medplum/core > SearchParameterDetails > type (9 words) - [core.reconnectingwebsocket.send | Medplum](/content/docs/sdk/core-reconnectingwebsocket-send.html): Home > @medplum/core > ReconnectingWebSocket > send (40 words) - [core.searchrequest.fields | Medplum](/content/docs/sdk/core-searchrequest-fields.html): Home > @medplum/core > SearchRequest > fields (7 words) - [core.reorderbundle | Medplum](/content/docs/sdk/core-reorderbundle.html): Home > @medplum/core > reorderBundle (108 words) - [core.resolvesmarthealthlinkparams.passcode | Medplum](/content/docs/sdk/core-resolvesmarthealthlinkparams-passcode.html): Home > @medplum/core > ResolveSmartHealthLinkParams > passcode (8 words) - [core.readablepromise | Medplum](/content/docs/sdk/core-readablepromise.html): Home > @medplum/core > ReadablePromise (156 words) - [core.resourcearray | Medplum](/content/docs/sdk/core-resourcearray.html): Home > @medplum/core > ResourceArray (54 words) - [core.searchabletoken.system | Medplum](/content/docs/sdk/core-searchabletoken-system.html): Home > @medplum/core > SearchableToken > system (14 words) - [core.resourcematchessubscriptioncriteria | Medplum](/content/docs/sdk/core-resourcematchessubscriptioncriteria.html): Home > @medplum/core > ResourceMatchesSubscriptionCriteria (30 words) - [core.searchabletoken.value | Medplum](/content/docs/sdk/core-searchabletoken-value.html): Home > @medplum/core > SearchableToken > value (10 words) - [core.resolvesmarthealthlinkparams.recipient | Medplum](/content/docs/sdk/core-resolvesmarthealthlinkparams-recipient.html): Home > @medplum/core > ResolveSmartHealthLinkParams > recipient (8 words) - [core.resourcemodifiedevent.id | Medplum](/content/docs/sdk/core-resourcemodifiedevent-id.html): Home > @medplum/core > ResourceModifiedEvent > id (12 words) - [core.prefixoperatoratom | Medplum](/content/docs/sdk/core-prefixoperatoratom.html): Home > @medplum/core > PrefixOperatorAtom (71 words) - [core.removepreferredpharmacyfrompatient | Medplum](/content/docs/sdk/core-removepreferredpharmacyfrompatient.html): Home > @medplum/core > removePreferredPharmacyFromPatient (46 words) - [core.resourcemodifiedevent.resourcetype | Medplum](/content/docs/sdk/core-resourcemodifiedevent-resourcetype.html): Home > @medplum/core > ResourceModifiedEvent > resourceType (13 words) - [core.schedulingdurationtominutes | Medplum](/content/docs/sdk/core-schedulingdurationtominutes.html): Home > @medplum/core > schedulingDurationToMinutes (57 words) - [core.reconnectingwebsocket.onopen | Medplum](/content/docs/sdk/core-reconnectingwebsocket-onopen.html): Home > @medplum/core > ReconnectingWebSocket > onopen (38 words) - [core.removeoperation | Medplum](/content/docs/sdk/core-removeoperation.html): Home > @medplum/core > RemoveOperation (18 words) - [core.removeduplicates | Medplum](/content/docs/sdk/core-removeduplicates.html): Home > @medplum/core > removeDuplicates (37 words) - [core.requestcacheentry.value | Medplum](/content/docs/sdk/core-requestcacheentry-value.html): Home > @medplum/core > RequestCacheEntry > value (14 words) - [core.schedulingencountercodinguri | Medplum](/content/docs/sdk/core-schedulingencountercodinguri.html): Home > @medplum/core > SchedulingEncounterCodingURI (8 words) - [core.removeprofilefromresource | Medplum](/content/docs/sdk/core-removeprofilefromresource.html): Home > @medplum/core > removeProfileFromResource (49 words) - [core.parsestructuredefinition | Medplum](/content/docs/sdk/core-parsestructuredefinition.html): Home > @medplum/core > parseStructureDefinition (51 words) - [core.schedulingparametersuri | Medplum](/content/docs/sdk/core-schedulingparametersuri.html): Home > @medplum/core > SchedulingParametersURI (8 words) - [core.returnackcategory | Medplum](/content/docs/sdk/core-returnackcategory.html): Home > @medplum/core > ReturnAckCategory (14 words) - [core.replaceoperation.path | Medplum](/content/docs/sdk/core-replaceoperation-path.html): Home > @medplum/core > ReplaceOperation > path (13 words) - [core.readablepromise.then | Medplum](/content/docs/sdk/core-readablepromise-then.html): Home > @medplum/core > ReadablePromise > then (99 words) - [core.resolveid | Medplum](/content/docs/sdk/core-resolveid.html): Home > @medplum/core > resolveId (47 words) - [core.resourcemodifiedevent.resource | Medplum](/content/docs/sdk/core-resourcemodifiedevent-resource.html): Home > @medplum/core > ResourceModifiedEvent > resource (15 words) - [core.schedulingplandefinitionuri | Medplum](/content/docs/sdk/core-schedulingplandefinitionuri.html): Home > @medplum/core > SchedulingPlanDefinitionURI (6 words) - [core.requestprofileschemaoptions.expandprofile | Medplum](/content/docs/sdk/core-requestprofileschemaoptions-expandprofile.html): Home > @medplum/core > RequestProfileSchemaOptions > expandProfile (19 words) - [core.medplumclientoptions | Medplum](/content/docs/sdk/core-medplumclientoptions.html): Home > @medplum/core > MedplumClientOptions (852 words) - [core.requestcacheentry.requesttime | Medplum](/content/docs/sdk/core-requestcacheentry-requesttime.html): Home > @medplum/core > RequestCacheEntry > requestTime (9 words) - [core.reconnectingwebsocket._constructor_ | Medplum](/content/docs/sdk/core-reconnectingwebsocket-_constructor_.html): Home > @medplum/core > ReconnectingWebSocket > (constructor) (30 words) - [core.releasemanifest | Medplum](/content/docs/sdk/core-releasemanifest.html): Home > @medplum/core > ReleaseManifest (21 words) - [core.reconnectingwebsocket.binarytype | Medplum](/content/docs/sdk/core-reconnectingwebsocket-binarytype.html): Home > @medplum/core > ReconnectingWebSocket > binaryType (17 words) - [core.reconnectingwebsocket.shouldreconnect | Medplum](/content/docs/sdk/core-reconnectingwebsocket-shouldreconnect.html): Home > @medplum/core > ReconnectingWebSocket > shouldReconnect (9 words) - [core.redirect | Medplum](/content/docs/sdk/core-redirect.html): Home > @medplum/core > redirect (20 words) - [core.resourcemodifiedevent.operation | Medplum](/content/docs/sdk/core-resourcemodifiedevent-operation.html): Home > @medplum/core > ResourceModifiedEvent > operation (18 words) - [core.readhistoryoptions.offset | Medplum](/content/docs/sdk/core-readhistoryoptions-offset.html): Home > @medplum/core > ReadHistoryOptions > offset (14 words) - [core.removeoperation.op | Medplum](/content/docs/sdk/core-removeoperation-op.html): Home > @medplum/core > RemoveOperation > op (7 words) - [core.reconnectingwebsocket.readystate | Medplum](/content/docs/sdk/core-reconnectingwebsocket-readystate.html): Home > @medplum/core > ReconnectingWebSocket > readyState (9 words) - [core.reconnectingwebsocket.onerror | Medplum](/content/docs/sdk/core-reconnectingwebsocket-onerror.html): Home > @medplum/core > ReconnectingWebSocket > onerror (23 words) - [core.replaceoperation.op | Medplum](/content/docs/sdk/core-replaceoperation-op.html): Home > @medplum/core > ReplaceOperation > op (7 words) - [core.replaceoperation.value | Medplum](/content/docs/sdk/core-replaceoperation-value.html): Home > @medplum/core > ReplaceOperation > value (7 words) - [core.reconnectingwebsocket.bufferedamount | Medplum](/content/docs/sdk/core-reconnectingwebsocket-bufferedamount.html): Home > @medplum/core > ReconnectingWebSocket > bufferedAmount (9 words) - [core.reconnectingwebsocket.extensions | Medplum](/content/docs/sdk/core-reconnectingwebsocket-extensions.html): Home > @medplum/core > ReconnectingWebSocket > extensions (9 words) - [core.reconnectingwebsocket.retrycount | Medplum](/content/docs/sdk/core-reconnectingwebsocket-retrycount.html): Home > @medplum/core > ReconnectingWebSocket > retryCount (9 words) - [core.redirectok | Medplum](/content/docs/sdk/core-redirectok.html): Home > @medplum/core > redirectOk (20 words) - [core.readablepromise.finally | Medplum](/content/docs/sdk/core-readablepromise-finally.html): Home > @medplum/core > ReadablePromise > finally (61 words) - [core.reconnectingwebsocket.protocol | Medplum](/content/docs/sdk/core-reconnectingwebsocket-protocol.html): Home > @medplum/core > ReconnectingWebSocket > protocol (9 words) - [core.reconnectingwebsocket.closed | Medplum](/content/docs/sdk/core-reconnectingwebsocket-closed.html): Home > @medplum/core > ReconnectingWebSocket > CLOSED (9 words) - [core.reconnectingwebsocket.onmessage | Medplum](/content/docs/sdk/core-reconnectingwebsocket-onmessage.html): Home > @medplum/core > ReconnectingWebSocket > onmessage (26 words) - [core.reconnectingwebsocket.open | Medplum](/content/docs/sdk/core-reconnectingwebsocket-open.html): Home > @medplum/core > ReconnectingWebSocket > OPEN (9 words) - [core.patchoptions.implicitarraycreation | Medplum](/content/docs/sdk/core-patchoptions-implicitarraycreation.html): Home > @medplum/core > PatchOptions > implicitArrayCreation (95 words) - [core.pushtoagentoptions.waittimeout | Medplum](/content/docs/sdk/core-pushtoagentoptions-waittimeout.html): Home > @medplum/core > PushToAgentOptions > waitTimeout (20 words) - [core.reconnectingwebsocket._protocols | Medplum](/content/docs/sdk/core-reconnectingwebsocket-_protocols.html): Home > @medplum/core > ReconnectingWebSocket > \protocols (8 words) - [core.reconnectingwebsocket.onclose | Medplum](/content/docs/sdk/core-reconnectingwebsocket-onclose.html): Home > @medplum/core > ReconnectingWebSocket > onclose (26 words) - [core.reconnectingwebsocket.closing | Medplum](/content/docs/sdk/core-reconnectingwebsocket-closing.html): Home > @medplum/core > ReconnectingWebSocket > CLOSING (9 words) - [core.reconnectingwebsocket._options | Medplum](/content/docs/sdk/core-reconnectingwebsocket-_options.html): Home > @medplum/core > ReconnectingWebSocket > \options (8 words) - [core.pointer | Medplum](/content/docs/sdk/core-pointer.html): Home > @medplum/core > Pointer (110 words) - [core.readablepromise.read | Medplum](/content/docs/sdk/core-readablepromise-read.html): Home > @medplum/core > ReadablePromise > read (56 words) - [core.readablepromise.isok | Medplum](/content/docs/sdk/core-readablepromise-isok.html): Home > @medplum/core > ReadablePromise > isOk (23 words) - [core.readhistoryoptions.count | Medplum](/content/docs/sdk/core-readhistoryoptions-count.html): Home > @medplum/core > ReadHistoryOptions > count (9 words) - [core.readablepromise.ispending | Medplum](/content/docs/sdk/core-readablepromise-ispending.html): Home > @medplum/core > ReadablePromise > isPending (23 words) - [core.parsexfhirquery | Medplum](/content/docs/sdk/core-parsexfhirquery.html): Home > @medplum/core > parseXFhirQuery (89 words) - [core.pushtoagentoptions | Medplum](/content/docs/sdk/core-pushtoagentoptions.html): Home > @medplum/core > PushToAgentOptions (70 words) - [core.readablepromise.catch | Medplum](/content/docs/sdk/core-readablepromise-catch.html): Home > @medplum/core > ReadablePromise > catch (62 words) - [core.parserbuilder.prefix | Medplum](/content/docs/sdk/core-parserbuilder-prefix.html): Home > @medplum/core > ParserBuilder > prefix (37 words) - [core.querytypes | Medplum](/content/docs/sdk/core-querytypes.html): Home > @medplum/core > QueryTypes (71 words) - [core.precisegreaterthan | Medplum](/content/docs/sdk/core-precisegreaterthan.html): Home > @medplum/core > preciseGreaterThan (74 words) - [core.prefixoperatoratom.eval | Medplum](/content/docs/sdk/core-prefixoperatoratom-eval.html): Home > @medplum/core > PrefixOperatorAtom > eval (28 words) - [core.parser.getinfixparselet | Medplum](/content/docs/sdk/core-parser-getinfixparselet.html): Home > @medplum/core > Parser > getInfixParselet (21 words) - [core.parser | Medplum](/content/docs/sdk/core-parser.html): Home > @medplum/core > Parser (39 words) - [core.readablepromise._symbol.tostringtag_ | Medplum](/content/docs/sdk/core-readablepromise-_symbol-tostringtag_.html): Home > @medplum/core > ReadablePromise > \[Symbol.toStringTag\] (9 words) - [core.protocolsprovider | Medplum](/content/docs/sdk/core-protocolsprovider.html): Home > @medplum/core > ProtocolsProvider (20 words) - [core.preciseequals | Medplum](/content/docs/sdk/core-preciseequals.html): Home > @medplum/core > preciseEquals (61 words) - [core.parserbuilder.registerprefix | Medplum](/content/docs/sdk/core-parserbuilder-registerprefix.html): Home > @medplum/core > ParserBuilder > registerPrefix (27 words) - [core.parsefhirpathpatchparameters | Medplum](/content/docs/sdk/core-parsefhirpathpatchparameters.html): Home > @medplum/core > parseFhirPathPatchParameters (71 words) - [core.pharmacysearchparams.address | Medplum](/content/docs/sdk/core-pharmacysearchparams-address.html): Home > @medplum/core > PharmacySearchParams > address (7 words) - [core.parserbuilder | Medplum](/content/docs/sdk/core-parserbuilder.html): Home > @medplum/core > ParserBuilder (36 words) - [core.ordersetsyncsequenceresult | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult.html): Home > @medplum/core > OrderSetSyncSequenceResult (79 words) - [core.parserbuilder.infixleft | Medplum](/content/docs/sdk/core-parserbuilder-infixleft.html): Home > @medplum/core > ParserBuilder > infixLeft (45 words) - [core.prefixparselet.parse | Medplum](/content/docs/sdk/core-prefixparselet-parse.html): Home > @medplum/core > PrefixParselet > parse (23 words) - [core.patchoptions | Medplum](/content/docs/sdk/core-patchoptions.html): Home > @medplum/core > PatchOptions (98 words) - [core.preferredpharmacy | Medplum](/content/docs/sdk/core-preferredpharmacy.html): Home > @medplum/core > PreferredPharmacy (15 words) - [core.precisegreaterthanorequals | Medplum](/content/docs/sdk/core-precisegreaterthanorequals.html): Home > @medplum/core > preciseGreaterThanOrEquals (77 words) - [core.patchoperation | Medplum](/content/docs/sdk/core-patchoperation.html): Home > @medplum/core > PatchOperation (43 words) - [core.projectadminresourcetypes | Medplum](/content/docs/sdk/core-projectadminresourcetypes.html): Home > @medplum/core > projectAdminResourceTypes (27 words) - [core.parameterstomedicationordersetresponse | Medplum](/content/docs/sdk/core-parameterstomedicationordersetresponse.html): Home > @medplum/core > parametersToMedicationOrderSetResponse (79 words) - [core.parserbuilder.construct | Medplum](/content/docs/sdk/core-parserbuilder-construct.html): Home > @medplum/core > ParserBuilder > construct (23 words) - [core.quantityunit | Medplum](/content/docs/sdk/core-quantityunit.html): Home > @medplum/core > QuantityUnit (15 words) - [core.pointerevaluation | Medplum](/content/docs/sdk/core-pointerevaluation.html): Home > @medplum/core > PointerEvaluation (20 words) - [core.pointer._constructor_ | Medplum](/content/docs/sdk/core-pointer-_constructor_.html): Home > @medplum/core > Pointer > (constructor) (21 words) - [core.parsesearchrequest | Medplum](/content/docs/sdk/core-parsesearchrequest.html): Home > @medplum/core > parseSearchRequest (70 words) - [core.parameterstomedicationcartmanageresponse | Medplum](/content/docs/sdk/core-parameterstomedicationcartmanageresponse.html): Home > @medplum/core > parametersToMedicationCartManageResponse (53 words) - [core.pointer.fromjson | Medplum](/content/docs/sdk/core-pointer-fromjson.html): Home > @medplum/core > Pointer > fromJSON (31 words) - [core.pathtojsonpointer | Medplum](/content/docs/sdk/core-pathtojsonpointer.html): Home > @medplum/core > pathToJSONPointer (46 words) - [core.pharmacysearchparams.organization | Medplum](/content/docs/sdk/core-pharmacysearchparams-organization.html): Home > @medplum/core > PharmacySearchParams > organization (13 words) - [core.patchoperation.value | Medplum](/content/docs/sdk/core-patchoperation-value.html): Home > @medplum/core > PatchOperation > value (14 words) - [core.parser._constructor_ | Medplum](/content/docs/sdk/core-parser-_constructor_.html): Home > @medplum/core > Parser > (constructor) (34 words) - [core.pointer.evaluate | Medplum](/content/docs/sdk/core-pointer-evaluate.html): Home > @medplum/core > Pointer > evaluate (67 words) - [core.preciselessthan | Medplum](/content/docs/sdk/core-preciselessthan.html): Home > @medplum/core > preciseLessThan (69 words) - [core.protectedresourcetypes | Medplum](/content/docs/sdk/core-protectedresourcetypes.html): Home > @medplum/core > protectedResourceTypes (23 words) - [core.parsereference | Medplum](/content/docs/sdk/core-parsereference.html): Home > @medplum/core > parseReference (60 words) - [core.preciseround | Medplum](/content/docs/sdk/core-preciseround.html): Home > @medplum/core > preciseRound (50 words) - [core.pointer.add | Medplum](/content/docs/sdk/core-pointer-add.html): Home > @medplum/core > Pointer > add (27 words) - [core.pointer.get | Medplum](/content/docs/sdk/core-pointer-get.html): Home > @medplum/core > Pointer > get (23 words) - [core.pharmacy_preference_type_system | Medplum](/content/docs/sdk/core-pharmacy_preference_type_system.html): Home > @medplum/core > PHARMACY\PREFERENCE\TYPE\SYSTEM (28 words) - [core.patient_preferred_pharmacy_url | Medplum](/content/docs/sdk/core-patient_preferred_pharmacy_url.html): Home > @medplum/core > PATIENT\PREFERRED\PHARMACY\URL (14 words) - [core.parameterstoordersetsyncresponse | Medplum](/content/docs/sdk/core-parameterstoordersetsyncresponse.html): Home > @medplum/core > parametersToOrderSetSyncResponse (53 words) - [core.prefixoperatoratom.operator | Medplum](/content/docs/sdk/core-prefixoperatoratom-operator.html): Home > @medplum/core > PrefixOperatorAtom > operator (9 words) - [core.prefixoperatoratom.tostring | Medplum](/content/docs/sdk/core-prefixoperatoratom-tostring.html): Home > @medplum/core > PrefixOperatorAtom > toString (10 words) - [core.patch | Medplum](/content/docs/sdk/core-patch.html): Home > @medplum/core > Patch (12 words) - [core.pointer.set | Medplum](/content/docs/sdk/core-pointer-set.html): Home > @medplum/core > Pointer > set (21 words) - [core.prefixoperatoratom._constructor_ | Medplum](/content/docs/sdk/core-prefixoperatoratom-_constructor_.html): Home > @medplum/core > PrefixOperatorAtom > (constructor) (22 words) - [core.parser.peek | Medplum](/content/docs/sdk/core-parser-peek.html): Home > @medplum/core > Parser > peek (14 words) - [core.pointer.push | Medplum](/content/docs/sdk/core-pointer-push.html): Home > @medplum/core > Pointer > push (17 words) - [core.profileresource | Medplum](/content/docs/sdk/core-profileresource.html): Home > @medplum/core > ProfileResource (14 words) - [core.patchoperation.path | Medplum](/content/docs/sdk/core-patchoperation-path.html): Home > @medplum/core > PatchOperation > path (9 words) - [core.parsehl7datetime | Medplum](/content/docs/sdk/core-parsehl7datetime.html): Home > @medplum/core > parseHl7DateTime (65 words) - [core.parser.hasmore | Medplum](/content/docs/sdk/core-parser-hasmore.html): Home > @medplum/core > Parser > hasMore (10 words) - [core.pendingsubscriptionrequest | Medplum](/content/docs/sdk/core-pendingsubscriptionrequest.html): Home > @medplum/core > PendingSubscriptionRequest (12 words) - [core.pointerevaluation.parent | Medplum](/content/docs/sdk/core-pointerevaluation-parent.html): Home > @medplum/core > PointerEvaluation > parent (7 words) - [core.parserbuilder.registerinfix | Medplum](/content/docs/sdk/core-parserbuilder-registerinfix.html): Home > @medplum/core > ParserBuilder > registerInfix (21 words) - [core.pharmacy_type_primary | Medplum](/content/docs/sdk/core-pharmacy_type_primary.html): Home > @medplum/core > PHARMACY\TYPE\PRIMARY (8 words) - [core.parsemappinglanguage | Medplum](/content/docs/sdk/core-parsemappinglanguage.html): Home > @medplum/core > parseMappingLanguage (39 words) - [core.pharmacysearchparams.name | Medplum](/content/docs/sdk/core-pharmacysearchparams-name.html): Home > @medplum/core > PharmacySearchParams > name (7 words) - [core.pharmacysearchparams.phoneorfax | Medplum](/content/docs/sdk/core-pharmacysearchparams-phoneorfax.html): Home > @medplum/core > PharmacySearchParams > phoneOrFax (8 words) - [core.preferredpharmacy.isprimary | Medplum](/content/docs/sdk/core-preferredpharmacy-isprimary.html): Home > @medplum/core > PreferredPharmacy > isPrimary (7 words) - [core.pharmacy_type_preferred | Medplum](/content/docs/sdk/core-pharmacy_type_preferred.html): Home > @medplum/core > PHARMACY\TYPE\PREFERRED (9 words) - [core.parsesmarthealthlink | Medplum](/content/docs/sdk/core-parsesmarthealthlink.html): Home > @medplum/core > parseSmartHealthLink (17 words) - [core.pointer.parent | Medplum](/content/docs/sdk/core-pointer-parent.html): Home > @medplum/core > Pointer > parent (29 words) - [core.pointerevaluation.value | Medplum](/content/docs/sdk/core-pointerevaluation-value.html): Home > @medplum/core > PointerEvaluation > value (13 words) - [core.parameterstomedicationcheckoutresponse | Medplum](/content/docs/sdk/core-parameterstomedicationcheckoutresponse.html): Home > @medplum/core > parametersToMedicationCheckoutResponse (70 words) - [core.parser.match | Medplum](/content/docs/sdk/core-parser-match.html): Home > @medplum/core > Parser > match (17 words) - [core.pointer.tokens | Medplum](/content/docs/sdk/core-pointer-tokens.html): Home > @medplum/core > Pointer > tokens (7 words) - [core.parsejwtpayload | Medplum](/content/docs/sdk/core-parsejwtpayload.html): Home > @medplum/core > parseJWTPayload (32 words) - [core.pharmacysearchparams.city | Medplum](/content/docs/sdk/core-pharmacysearchparams-city.html): Home > @medplum/core > PharmacySearchParams > city (8 words) - [core.patchoperation.op | Medplum](/content/docs/sdk/core-patchoperation-op.html): Home > @medplum/core > PatchOperation > op (19 words) - [core.pointer.tostring | Medplum](/content/docs/sdk/core-pointer-tostring.html): Home > @medplum/core > Pointer > toString (8 words) - [core.parser.consumeandparse | Medplum](/content/docs/sdk/core-parser-consumeandparse.html): Home > @medplum/core > Parser > consumeAndParse (15 words) - [core.parser.getprecedence | Medplum](/content/docs/sdk/core-parser-getprecedence.html): Home > @medplum/core > Parser > getPrecedence (8 words) - [core.parseloglevel | Medplum](/content/docs/sdk/core-parseloglevel.html): Home > @medplum/core > parseLogLevel (20 words) - [core.parseparameter | Medplum](/content/docs/sdk/core-parseparameter.html): Home > @medplum/core > parseParameter (29 words) - [core.parser.consume | Medplum](/content/docs/sdk/core-parser-consume.html): Home > @medplum/core > Parser > consume (20 words) - [core.parameterstomedicationorderresponse | Medplum](/content/docs/sdk/core-parameterstomedicationorderresponse.html): Home > @medplum/core > parametersToMedicationOrderResponse (47 words) - [core.ordersetsyncsequenceresult.error | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-error.html): Home > @medplum/core > OrderSetSyncSequenceResult > error (9 words) - [core.parser.removecomments | Medplum](/content/docs/sdk/core-parser-removecomments.html): Home > @medplum/core > Parser > removeComments (9 words) - [core.parsefilterparameter | Medplum](/content/docs/sdk/core-parsefilterparameter.html): Home > @medplum/core > parseFilterParameter (36 words) - [core.ordersetsyncsequenceresult.scriptsuresequenceid | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-scriptsuresequenceid.html): Home > @medplum/core > OrderSetSyncSequenceResult > scriptSureSequenceId (9 words) - [core.ordersetsyncsequenceresult.status | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-status.html): Home > @medplum/core > OrderSetSyncSequenceResult > status (16 words) - [core.ordersetsyncsequenceresult.scriptsureorderid | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-scriptsureorderid.html): Home > @medplum/core > OrderSetSyncSequenceResult > scriptSureOrderId (9 words) - [core.outputrow | Medplum](/content/docs/sdk/core-outputrow.html): Home > @medplum/core > OutputRow (14 words) - [core.ordersetsyncsequenceresult.activitydefinitionurl | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-activitydefinitionurl.html): Home > @medplum/core > OrderSetSyncSequenceResult > activityDefinitionUrl (9 words) - [core.ordersetsyncresponse | Medplum](/content/docs/sdk/core-ordersetsyncresponse.html): Home > @medplum/core > OrderSetSyncResponse (61 words) - [core.operatorprecedence | Medplum](/content/docs/sdk/core-operatorprecedence.html): Home > @medplum/core > OperatorPrecedence (74 words) - [core.operator | Medplum](/content/docs/sdk/core-operator.html): Home > @medplum/core > Operator (90 words) - [core.ordersetsyncresponse.scriptsureordersetid | Medplum](/content/docs/sdk/core-ordersetsyncresponse-scriptsureordersetid.html): Home > @medplum/core > OrderSetSyncResponse > scriptSureOrdersetId (9 words) - [core.ordersetsyncsequenceresult.actiontitle | Medplum](/content/docs/sdk/core-ordersetsyncsequenceresult-actiontitle.html): Home > @medplum/core > OrderSetSyncSequenceResult > actionTitle (9 words) - [core.medplumsourceinfraconfig.rdssecretsarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdssecretsarn.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsSecretsArn (5 words) - [core.ordersetsyncresponse.results | Medplum](/content/docs/sdk/core-ordersetsyncresponse-results.html): Home > @medplum/core > OrderSetSyncResponse > results (9 words) - [core.medplumsourceinfraconfig.loadbalancersecuritygroupid | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-loadbalancersecuritygroupid.html): Home > @medplum/core > MedplumSourceInfraConfig > loadBalancerSecurityGroupId (8 words) - [core.ordersetsyncresponse.plandefinitionid | Medplum](/content/docs/sdk/core-ordersetsyncresponse-plandefinitionid.html): Home > @medplum/core > OrderSetSyncResponse > planDefinitionId (8 words) - [core.operationoutcomeerror | Medplum](/content/docs/sdk/core-operationoutcomeerror.html): Home > @medplum/core > OperationOutcomeError (53 words) - [core.options | Medplum](/content/docs/sdk/core-options.html): Home > @medplum/core > Options (44 words) - [core.oratom | Medplum](/content/docs/sdk/core-oratom.html): Home > @medplum/core > OrAtom (57 words) - [core.ordersetsyncresponse.syncedcount | Medplum](/content/docs/sdk/core-ordersetsyncresponse-syncedcount.html): Home > @medplum/core > OrderSetSyncResponse > syncedCount (8 words) - [core.oauthgranttype | Medplum](/content/docs/sdk/core-oauthgranttype.html): Home > @medplum/core > OAuthGrantType (45 words) - [core.ordersetsyncresponse.mode | Medplum](/content/docs/sdk/core-ordersetsyncresponse-mode.html): Home > @medplum/core > OrderSetSyncResponse > mode (10 words) - [core.medplumsourceinfraconfig.cloudtrailalarms | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cloudtrailalarms.html): Home > @medplum/core > MedplumSourceInfraConfig > cloudTrailAlarms (22 words) - [core.oratom.eval | Medplum](/content/docs/sdk/core-oratom-eval.html): Home > @medplum/core > OrAtom > eval (21 words) - [core.notequivalentatom.eval | Medplum](/content/docs/sdk/core-notequivalentatom-eval.html): Home > @medplum/core > NotEquivalentAtom > eval (23 words) - [core.operationoutcomeerror.outcome | Medplum](/content/docs/sdk/core-operationoutcomeerror-outcome.html): Home > @medplum/core > OperationOutcomeError > outcome (9 words) - [core.notfound | Medplum](/content/docs/sdk/core-notfound.html): Home > @medplum/core > notFound (7 words) - [core.operationoutcomeissuetostring | Medplum](/content/docs/sdk/core-operationoutcomeissuetostring.html): Home > @medplum/core > operationOutcomeIssueToString (38 words) - [core.operation | Medplum](/content/docs/sdk/core-operation.html): Home > @medplum/core > Operation (33 words) - [core.newuserrequest.email | Medplum](/content/docs/sdk/core-newuserrequest-email.html): Home > @medplum/core > NewUserRequest > email (8 words) - [core.normalizeerrorevent | Medplum](/content/docs/sdk/core-normalizeerrorevent.html): Home > @medplum/core > normalizeErrorEvent (134 words) - [core.newuserrequest | Medplum](/content/docs/sdk/core-newuserrequest.html): Home > @medplum/core > NewUserRequest (46 words) - [core.normalizearraybufferview | Medplum](/content/docs/sdk/core-normalizearraybufferview.html): Home > @medplum/core > normalizeArrayBufferView (115 words) - [core.oratom._constructor_ | Medplum](/content/docs/sdk/core-oratom-_constructor_.html): Home > @medplum/core > OrAtom > (constructor) (22 words) - [core.memorystorage | Medplum](/content/docs/sdk/core-memorystorage.html): Home > @medplum/core > MemoryStorage (152 words) - [core.notequivalentatom | Medplum](/content/docs/sdk/core-notequivalentatom.html): Home > @medplum/core > NotEquivalentAtom (35 words) - [core.move | Medplum](/content/docs/sdk/core-move.html): Home > @medplum/core > move (166 words) - [core.normalizecreatepdfoptions | Medplum](/content/docs/sdk/core-normalizecreatepdfoptions.html): Home > @medplum/core > normalizeCreatePdfOptions (48 words) - [core.medplumclientoptions.createpdf | Medplum](/content/docs/sdk/core-medplumclientoptions-createpdf.html): Home > @medplum/core > MedplumClientOptions > createPdf (138 words) - [core.medplumsourceinfraconfig.workers | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-workers.html): Home > @medplum/core > MedplumSourceInfraConfig > workers (14 words) - [core.normalizeoperationoutcome | Medplum](/content/docs/sdk/core-normalizeoperationoutcome.html): Home > @medplum/core > normalizeOperationOutcome (41 words) - [core.medplumsourceinfraconfig.maxazs | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-maxazs.html): Home > @medplum/core > MedplumSourceInfraConfig > maxAzs (7 words) - [core.medplumsourceinfraconfig.fargateautoscaling | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-fargateautoscaling.html): Home > @medplum/core > MedplumSourceInfraConfig > fargateAutoScaling (18 words) - [core.newprojectrequest.projectname | Medplum](/content/docs/sdk/core-newprojectrequest-projectname.html): Home > @medplum/core > NewProjectRequest > projectName (8 words) - [core.newuserrequest.lastname | Medplum](/content/docs/sdk/core-newuserrequest-lastname.html): Home > @medplum/core > NewUserRequest > lastName (9 words) - [core.mockasyncclientstorage.setinitialized | Medplum](/content/docs/sdk/core-mockasyncclientstorage-setinitialized.html): Home > @medplum/core > MockAsyncClientStorage > setInitialized (10 words) - [core.newpatientrequest | Medplum](/content/docs/sdk/core-newpatientrequest.html): Home > @medplum/core > NewPatientRequest (31 words) - [core.medplumsourceinfraconfig.storagebucketname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storagebucketname.html): Home > @medplum/core > MedplumSourceInfraConfig > storageBucketName (7 words) - [core.normalizecreatebinaryoptions | Medplum](/content/docs/sdk/core-normalizecreatebinaryoptions.html): Home > @medplum/core > normalizeCreateBinaryOptions (51 words) - [core.mockasyncclientstorage | Medplum](/content/docs/sdk/core-mockasyncclientstorage.html): Home > @medplum/core > MockAsyncClientStorage (64 words) - [core.ordersetsyncresponse.failedcount | Medplum](/content/docs/sdk/core-ordersetsyncresponse-failedcount.html): Home > @medplum/core > OrderSetSyncResponse > failedCount (9 words) - [core.newuserrequest.recaptchatoken | Medplum](/content/docs/sdk/core-newuserrequest-recaptchatoken.html): Home > @medplum/core > NewUserRequest > recaptchaToken (9 words) - [core.medplumkeyvalueclient._constructor_ | Medplum](/content/docs/sdk/core-medplumkeyvalueclient-_constructor_.html): Home > @medplum/core > MedplumKeyValueClient > (constructor) (20 words) - [core.notequalsatom | Medplum](/content/docs/sdk/core-notequalsatom.html): Home > @medplum/core > NotEqualsAtom (35 words) - [core.oauthsigningalgorithm | Medplum](/content/docs/sdk/core-oauthsigningalgorithm.html): Home > @medplum/core > OAuthSigningAlgorithm (44 words) - [core.notequivalentatom._constructor_ | Medplum](/content/docs/sdk/core-notequivalentatom-_constructor_.html): Home > @medplum/core > NotEquivalentAtom > (constructor) (22 words) - [core.operationoutcometostring | Medplum](/content/docs/sdk/core-operationoutcometostring.html): Home > @medplum/core > operationOutcomeToString (35 words) - [core.notequalsatom.eval | Medplum](/content/docs/sdk/core-notequalsatom-eval.html): Home > @medplum/core > NotEqualsAtom > eval (23 words) - [core.oauthtokentype | Medplum](/content/docs/sdk/core-oauthtokentype.html): Home > @medplum/core > OAuthTokenType (42 words) - [core.oauthclientassertiontype | Medplum](/content/docs/sdk/core-oauthclientassertiontype.html): Home > @medplum/core > OAuthClientAssertionType (24 words) - [core.notmodified | Medplum](/content/docs/sdk/core-notmodified.html): Home > @medplum/core > notModified (5 words) - [core.newuserrequest.password | Medplum](/content/docs/sdk/core-newuserrequest-password.html): Home > @medplum/core > NewUserRequest > password (9 words) - [core.memorystorage.key | Medplum](/content/docs/sdk/core-memorystorage-key.html): Home > @medplum/core > MemoryStorage > key (46 words) - [core.noop | Medplum](/content/docs/sdk/core-noop.html): Home > @medplum/core > NOOP (14 words) - [core.newuserrequest.firstname | Medplum](/content/docs/sdk/core-newuserrequest-firstname.html): Home > @medplum/core > NewUserRequest > firstName (14 words) - [core.memorystorage.length | Medplum](/content/docs/sdk/core-memorystorage-length.html): Home > @medplum/core > MemoryStorage > length (20 words) - [core.memorystorage.clear | Medplum](/content/docs/sdk/core-memorystorage-clear.html): Home > @medplum/core > MemoryStorage > clear (18 words) - [core.newuserrequest.clientid | Medplum](/content/docs/sdk/core-newuserrequest-clientid.html): Home > @medplum/core > NewUserRequest > clientId (9 words) - [core.newuserrequest.recaptchasitekey | Medplum](/content/docs/sdk/core-newuserrequest-recaptchasitekey.html): Home > @medplum/core > NewUserRequest > recaptchaSiteKey (6 words) - [core.newprojectrequest.login | Medplum](/content/docs/sdk/core-newprojectrequest-login.html): Home > @medplum/core > NewProjectRequest > login (14 words) - [core.mockasyncclientstorage.getinitpromise | Medplum](/content/docs/sdk/core-mockasyncclientstorage-getinitpromise.html): Home > @medplum/core > MockAsyncClientStorage > getInitPromise (9 words) - [core.newuserrequest.projectid | Medplum](/content/docs/sdk/core-newuserrequest-projectid.html): Home > @medplum/core > NewUserRequest > projectId (9 words) - [core.ndc | Medplum](/content/docs/sdk/core-ndc.html): Home > @medplum/core > NDC (6 words) - [core.message | Medplum](/content/docs/sdk/core-message.html): Home > @medplum/core > Message (16 words) - [core.newprojectrequest | Medplum](/content/docs/sdk/core-newprojectrequest.html): Home > @medplum/core > NewProjectRequest (17 words) - [core.moveoperation | Medplum](/content/docs/sdk/core-moveoperation.html): Home > @medplum/core > MoveOperation (20 words) - [core.medplumsourceinfraconfig.wafloggroupname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-wafloggroupname.html): Home > @medplum/core > MedplumSourceInfraConfig > wafLogGroupName (8 words) - [core.medplumsourceinfraconfig.region | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-region.html): Home > @medplum/core > MedplumSourceInfraConfig > region (8 words) - [core.normalizeerrorstring | Medplum](/content/docs/sdk/core-normalizeerrorstring.html): Home > @medplum/core > normalizeErrorString (46 words) - [core.memorystorage.setitem | Medplum](/content/docs/sdk/core-memorystorage-setitem.html): Home > @medplum/core > MemoryStorage > setItem (59 words) - [core.missingerror._constructor_ | Medplum](/content/docs/sdk/core-missingerror-_constructor_.html): Home > @medplum/core > MissingError > (constructor) (20 words) - [core.medpluminfraconfig.rdsclusterparameters | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsclusterparameters.html): Home > @medplum/core > MedplumInfraConfig > rdsClusterParameters (8 words) - [core.medplumsourceinfraconfig.clamscanenabled | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-clamscanenabled.html): Home > @medplum/core > MedplumSourceInfraConfig > clamscanEnabled (17 words) - [core.newpatientrequest.projectid | Medplum](/content/docs/sdk/core-newpatientrequest-projectid.html): Home > @medplum/core > NewPatientRequest > projectId (8 words) - [core.newuserrequest.remember | Medplum](/content/docs/sdk/core-newuserrequest-remember.html): Home > @medplum/core > NewUserRequest > remember (9 words) - [core.missingerror.path | Medplum](/content/docs/sdk/core-missingerror-path.html): Home > @medplum/core > MissingError > path (8 words) - [core.missingerror | Medplum](/content/docs/sdk/core-missingerror.html): Home > @medplum/core > MissingError (31 words) - [core.memorystorage.removeitem | Medplum](/content/docs/sdk/core-memorystorage-removeitem.html): Home > @medplum/core > MemoryStorage > removeItem (37 words) - [core.medplumsourceinfraconfig.pubsubredis | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-pubsubredis.html): Home > @medplum/core > MedplumSourceInfraConfig > pubSubRedis (17 words) - [core.medplumsourceinfraconfig.ratelimitredis | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-ratelimitredis.html): Home > @medplum/core > MedplumSourceInfraConfig > rateLimitRedis (16 words) - [core.medplumsourceinfraconfig.storagesslcertarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storagesslcertarn.html): Home > @medplum/core > MedplumSourceInfraConfig > storageSslCertArn (8 words) - [core.medplumsourceinfraconfig.guarddutymalwareprotectionenabled | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-guarddutymalwareprotectionenabled.html): Home > @medplum/core > MedplumSourceInfraConfig > guardDutyMalwareProtectionEnabled (8 words) - [core.medplumsourceinfraconfig.storagewafipsetarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storagewafipsetarn.html): Home > @medplum/core > MedplumSourceInfraConfig > storageWafIpSetArn (7 words) - [core.medplumsourceinfraconfig.storageloggingbucket | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storageloggingbucket.html): Home > @medplum/core > MedplumSourceInfraConfig > storageLoggingBucket (7 words) - [core.medplumsourceinfraconfig.skipdns | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-skipdns.html): Home > @medplum/core > MedplumSourceInfraConfig > skipDns (8 words) - [core.medplumsourceinfraconfig.wafloggroupcreate | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-wafloggroupcreate.html): Home > @medplum/core > MedplumSourceInfraConfig > wafLogGroupCreate (7 words) - [core.medplumsourceinfraconfig.servercpu | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-servercpu.html): Home > @medplum/core > MedplumSourceInfraConfig > serverCpu (7 words) - [core.medplumsourceinfraconfig.servermemory | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-servermemory.html): Home > @medplum/core > MedplumSourceInfraConfig > serverMemory (8 words) - [core.medplumsourceinfraconfig.rdsproxyenabled | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsproxyenabled.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsProxyEnabled (8 words) - [core.medplumsourceinfraconfig.storagepublickey | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storagepublickey.html): Home > @medplum/core > MedplumSourceInfraConfig > storagePublicKey (8 words) - [core.medplumrequestoptions | Medplum](/content/docs/sdk/core-medplumrequestoptions.html): Home > @medplum/core > MedplumRequestOptions (149 words) - [core.medplumrequestoptions.followredirectoncreated | Medplum](/content/docs/sdk/core-medplumrequestoptions-followredirectoncreated.html): Home > @medplum/core > MedplumRequestOptions > followRedirectOnCreated (21 words) - [core.medplumsourceinfraconfig.containerinsightsv2 | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-containerinsightsv2.html): Home > @medplum/core > MedplumSourceInfraConfig > containerInsightsV2 (12 words) - [core.medplumsourceinfraconfig.loadbalancerloggingprefix | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-loadbalancerloggingprefix.html): Home > @medplum/core > MedplumSourceInfraConfig > loadBalancerLoggingPrefix (7 words) - [core.medplumsourceinfraconfig.additionalcontainers | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-additionalcontainers.html): Home > @medplum/core > MedplumSourceInfraConfig > additionalContainers (26 words) - [core.medplumrequestoptions.pollstatusperiod | Medplum](/content/docs/sdk/core-medplumrequestoptions-pollstatusperiod.html): Home > @medplum/core > MedplumRequestOptions > pollStatusPeriod (19 words) - [core.medplumsourceinfraconfig.cacheengine | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cacheengine.html): Home > @medplum/core > MedplumSourceInfraConfig > cacheEngine (13 words) - [core.medplumsourceinfraconfig.rdsreaderinstancetype | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsreaderinstancetype.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsReaderInstanceType (7 words) - [core.memorystorage.getitem | Medplum](/content/docs/sdk/core-memorystorage-getitem.html): Home > @medplum/core > MemoryStorage > getItem (60 words) - [core.medplumsourceinfraconfig.mtlssslcertarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-mtlssslcertarn.html): Home > @medplum/core > MedplumSourceInfraConfig > mtlsSslCertArn (8 words) - [core.medpluminfraconfig.workerservices | Medplum](/content/docs/sdk/core-medpluminfraconfig-workerservices.html): Home > @medplum/core > MedplumInfraConfig > workerServices (63 words) - [core.medplumkeyvalueclient.delete | Medplum](/content/docs/sdk/core-medplumkeyvalueclient-delete.html): Home > @medplum/core > MedplumKeyValueClient > delete (41 words) - [core.medplumsourceinfraconfig.stackname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-stackname.html): Home > @medplum/core > MedplumSourceInfraConfig > stackName (6 words) - [core.medplumsourceinfraconfig.signingkeyid | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-signingkeyid.html): Home > @medplum/core > MedplumSourceInfraConfig > signingKeyId (7 words) - [core.medplumsourceinfraconfig.firelens | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-firelens.html): Home > @medplum/core > MedplumSourceInfraConfig > fireLens (41 words) - [core.medpluminfraconfig.rdsinstanceversion | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsinstanceversion.html): Home > @medplum/core > MedplumInfraConfig > rdsInstanceVersion (7 words) - [core.medplumsourceinfraconfig.baseurl | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-baseurl.html): Home > @medplum/core > MedplumSourceInfraConfig > baseUrl (7 words) - [core.memorystorage._constructor_ | Medplum](/content/docs/sdk/core-memorystorage-_constructor_.html): Home > @medplum/core > MemoryStorage > (constructor) (12 words) - [core.medplumclient.unsubscribefromcriteria | Medplum](/content/docs/sdk/core-medplumclient-unsubscribefromcriteria.html): Home > @medplum/core > MedplumClient > unsubscribeFromCriteria (64 words) - [core.medplumsourceinfraconfig.rdsinstances | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsinstances.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsInstances (7 words) - [core.medplumsourceinfraconfig.hostedzonename | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-hostedzonename.html): Home > @medplum/core > MedplumSourceInfraConfig > hostedZoneName (5 words) - [core.medplumkeyvalueclient | Medplum](/content/docs/sdk/core-medplumkeyvalueclient.html): Home > @medplum/core > MedplumKeyValueClient (69 words) - [core.medplumsourceinfraconfig.loadbalancerloggingbucket | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-loadbalancerloggingbucket.html): Home > @medplum/core > MedplumSourceInfraConfig > loadBalancerLoggingBucket (8 words) - [core.medplumsourceinfraconfig.desiredservercount | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-desiredservercount.html): Home > @medplum/core > MedplumSourceInfraConfig > desiredServerCount (7 words) - [core.medplumsourceinfraconfig.storageloggingprefix | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storageloggingprefix.html): Home > @medplum/core > MedplumSourceInfraConfig > storageLoggingPrefix (7 words) - [core.medplumsourceinfraconfig.cachesecuritygroupid | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cachesecuritygroupid.html): Home > @medplum/core > MedplumSourceInfraConfig > cacheSecurityGroupId (8 words) - [core.medplumsourceinfraconfig.cacheredis | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cacheredis.html): Home > @medplum/core > MedplumSourceInfraConfig > cacheRedis (17 words) - [core.medplumsourceinfraconfig.clamscanloggingbucket | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-clamscanloggingbucket.html): Home > @medplum/core > MedplumSourceInfraConfig > clamscanLoggingBucket (17 words) - [core.medplumrequestoptions.followredirectonok | Medplum](/content/docs/sdk/core-medplumrequestoptions-followredirectonok.html): Home > @medplum/core > MedplumRequestOptions > followRedirectOnOk (21 words) - [core.medplumsourceinfraconfig.domainname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-domainname.html): Home > @medplum/core > MedplumSourceInfraConfig > domainName (8 words) - [core.medplumsourceinfraconfig.containerregistrycredentialssecretarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-containerregistrycredentialssecretarn.html): Home > @medplum/core > MedplumSourceInfraConfig > containerRegistryCredentialsSecretArn (7 words) - [core.medplumkeyvalueclient.medplum | Medplum](/content/docs/sdk/core-medplumkeyvalueclient-medplum.html): Home > @medplum/core > MedplumKeyValueClient > medplum (8 words) - [core.medplumsourceinfraconfig.backgroundjobsredis | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-backgroundjobsredis.html): Home > @medplum/core > MedplumSourceInfraConfig > backgroundJobsRedis (16 words) - [core.medplumsourceinfraconfig.apploggingprefix | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apploggingprefix.html): Home > @medplum/core > MedplumSourceInfraConfig > appLoggingPrefix (7 words) - [core.medplumsourceinfraconfig.rdsinstancetype | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsinstancetype.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsInstanceType (7 words) - [core.medplumsourceinfraconfig.serverimage | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-serverimage.html): Home > @medplum/core > MedplumSourceInfraConfig > serverImage (8 words) - [core.medplumsourceinfraconfig.rdsautominorversionupgrade | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsautominorversionupgrade.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsAutoMinorVersionUpgrade (8 words) - [core.medplumsourceinfraconfig.cacheengineversion | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cacheengineversion.html): Home > @medplum/core > MedplumSourceInfraConfig > cacheEngineVersion (8 words) - [core.medplumsourceinfraconfig.rdsinstanceversion | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsinstanceversion.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsInstanceVersion (7 words) - [core.medplumsourceinfraconfig.apidomainname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apidomainname.html): Home > @medplum/core > MedplumSourceInfraConfig > apiDomainName (8 words) - [core.medplumrequestoptions.maxretries | Medplum](/content/docs/sdk/core-medplumrequestoptions-maxretries.html): Home > @medplum/core > MedplumRequestOptions > maxRetries (27 words) - [core.medplumsourceinfraconfig.rdsclusterparameters | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsclusterparameters.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsClusterParameters (7 words) - [core.medplumsourceinfraconfig.appsslcertarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-appsslcertarn.html): Home > @medplum/core > MedplumSourceInfraConfig > appSslCertArn (7 words) - [core.medplumsourceinfraconfig.apiport | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apiport.html): Home > @medplum/core > MedplumSourceInfraConfig > apiPort (8 words) - [core.medplumsourceinfraconfig.rdsidsmajorversionsuffix | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsidsmajorversionsuffix.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsIdsMajorVersionSuffix (7 words) - [core.medplumrequestoptions.maxretrytime | Medplum](/content/docs/sdk/core-medplumrequestoptions-maxretrytime.html): Home > @medplum/core > MedplumRequestOptions > maxRetryTime (22 words) - [core.medplumsourceinfraconfig.name | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-name.html): Home > @medplum/core > MedplumSourceInfraConfig > name (8 words) - [core.medpluminfraconfig.storagebucketname | Medplum](/content/docs/sdk/core-medpluminfraconfig-storagebucketname.html): Home > @medplum/core > MedplumInfraConfig > storageBucketName (8 words) - [core.medplumsourceinfraconfig.mtlsdomainname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-mtlsdomainname.html): Home > @medplum/core > MedplumSourceInfraConfig > mtlsDomainName (7 words) - [core.medicationordersetrequest | Medplum](/content/docs/sdk/core-medicationordersetrequest.html): Home > @medplum/core > MedicationOrderSetRequest (95 words) - [core.medplumsourceinfraconfig.appapiproxy | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-appapiproxy.html): Home > @medplum/core > MedplumSourceInfraConfig > appApiProxy (7 words) - [core.medpluminfraconfig.loadbalancerloggingbucket | Medplum](/content/docs/sdk/core-medpluminfraconfig-loadbalancerloggingbucket.html): Home > @medplum/core > MedplumInfraConfig > loadBalancerLoggingBucket (8 words) - [core.medplumsourceinfraconfig.mtlswafipsetarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-mtlswafipsetarn.html): Home > @medplum/core > MedplumSourceInfraConfig > mtlsWafIpSetArn (7 words) - [core.medpluminfraconfig.rdspersistentparametergroups | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdspersistentparametergroups.html): Home > @medplum/core > MedplumInfraConfig > rdsPersistentParameterGroups (8 words) - [core.medpluminfraconfig.serverimage | Medplum](/content/docs/sdk/core-medpluminfraconfig-serverimage.html): Home > @medplum/core > MedplumInfraConfig > serverImage (7 words) - [core.medpluminfraconfig.storageloggingbucket | Medplum](/content/docs/sdk/core-medpluminfraconfig-storageloggingbucket.html): Home > @medplum/core > MedplumInfraConfig > storageLoggingBucket (8 words) - [core.medpluminfraconfig.servercpu | Medplum](/content/docs/sdk/core-medpluminfraconfig-servercpu.html): Home > @medplum/core > MedplumInfraConfig > serverCpu (8 words) - [core.medpluminfraconfig.baseurl | Medplum](/content/docs/sdk/core-medpluminfraconfig-baseurl.html): Home > @medplum/core > MedplumInfraConfig > baseUrl (7 words) - [core.medpluminfraconfig.storagesslcertarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-storagesslcertarn.html): Home > @medplum/core > MedplumInfraConfig > storageSslCertArn (8 words) - [core.medplumclient.patch | Medplum](/content/docs/sdk/core-medplumclient-patch.html): Home > @medplum/core > MedplumClient > patch (81 words) - [core.medplumkeyvalueclient.set | Medplum](/content/docs/sdk/core-medplumkeyvalueclient-set.html): Home > @medplum/core > MedplumKeyValueClient > set (49 words) - [core.medplumsourceinfraconfig.apiinternetfacing | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apiinternetfacing.html): Home > @medplum/core > MedplumSourceInfraConfig > apiInternetFacing (7 words) - [core.medpluminfraconfig.storageloggingprefix | Medplum](/content/docs/sdk/core-medpluminfraconfig-storageloggingprefix.html): Home > @medplum/core > MedplumInfraConfig > storageLoggingPrefix (8 words) - [core.medplumsourceinfraconfig.clamscanloggingprefix | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-clamscanloggingprefix.html): Home > @medplum/core > MedplumSourceInfraConfig > clamscanLoggingPrefix (16 words) - [core.medplumsemver | Medplum](/content/docs/sdk/core-medplumsemver.html): Home > @medplum/core > MedplumSemver (13 words) - [core.medplumsourceinfraconfig.appwafipsetarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-appwafipsetarn.html): Home > @medplum/core > MedplumSourceInfraConfig > appWafIpSetArn (8 words) - [core.medpluminfraconfig.rdsidsmajorversionsuffix | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsidsmajorversionsuffix.html): Home > @medplum/core > MedplumInfraConfig > rdsIdsMajorVersionSuffix (13 words) - [core.medpluminfraconfig.skipdns | Medplum](/content/docs/sdk/core-medpluminfraconfig-skipdns.html): Home > @medplum/core > MedplumInfraConfig > skipDns (8 words) - [core.medpluminfraconfig.vpcid | Medplum](/content/docs/sdk/core-medpluminfraconfig-vpcid.html): Home > @medplum/core > MedplumInfraConfig > vpcId (7 words) - [core.medpluminfraconfig.wafloggroupcreate | Medplum](/content/docs/sdk/core-medpluminfraconfig-wafloggroupcreate.html): Home > @medplum/core > MedplumInfraConfig > wafLogGroupCreate (7 words) - [core.medplumsourceinfraconfig.accountnumber | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-accountnumber.html): Home > @medplum/core > MedplumSourceInfraConfig > accountNumber (7 words) - [core.medplumrequestoptions.disableautobatch | Medplum](/content/docs/sdk/core-medplumrequestoptions-disableautobatch.html): Home > @medplum/core > MedplumRequestOptions > disableAutoBatch (27 words) - [core.medplumrequestoptions.pollstatusonaccepted | Medplum](/content/docs/sdk/core-medplumrequestoptions-pollstatusonaccepted.html): Home > @medplum/core > MedplumRequestOptions > pollStatusOnAccepted (21 words) - [core.medpluminfraconfig.storagepublickey | Medplum](/content/docs/sdk/core-medpluminfraconfig-storagepublickey.html): Home > @medplum/core > MedplumInfraConfig > storagePublicKey (8 words) - [core.medplumkeyvalueclient.get | Medplum](/content/docs/sdk/core-medplumkeyvalueclient-get.html): Home > @medplum/core > MedplumKeyValueClient > get (42 words) - [core.medplumsourceinfraconfig.apiwafipsetarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apiwafipsetarn.html): Home > @medplum/core > MedplumSourceInfraConfig > apiWafIpSetArn (5 words) - [core.medpluminfraconfig.storagedomainname | Medplum](/content/docs/sdk/core-medpluminfraconfig-storagedomainname.html): Home > @medplum/core > MedplumInfraConfig > storageDomainName (7 words) - [core.medpluminfraconfig.storagewafipsetarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-storagewafipsetarn.html): Home > @medplum/core > MedplumInfraConfig > storageWafIpSetArn (7 words) - [core.medpluminfraconfig.name | Medplum](/content/docs/sdk/core-medpluminfraconfig-name.html): Home > @medplum/core > MedplumInfraConfig > name (8 words) - [core.medpluminfraconfig.rdssecretsarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdssecretsarn.html): Home > @medplum/core > MedplumInfraConfig > rdsSecretsArn (8 words) - [core.medpluminfraconfig.servermemory | Medplum](/content/docs/sdk/core-medpluminfraconfig-servermemory.html): Home > @medplum/core > MedplumInfraConfig > serverMemory (7 words) - [core.medpluminfraconfig.region | Medplum](/content/docs/sdk/core-medpluminfraconfig-region.html): Home > @medplum/core > MedplumInfraConfig > region (7 words) - [core.medpluminfraconfig.wafloggroupname | Medplum](/content/docs/sdk/core-medpluminfraconfig-wafloggroupname.html): Home > @medplum/core > MedplumInfraConfig > wafLogGroupName (7 words) - [core.medpluminfraconfig.ratelimitredis | Medplum](/content/docs/sdk/core-medpluminfraconfig-ratelimitredis.html): Home > @medplum/core > MedplumInfraConfig > rateLimitRedis (17 words) - [core.medpluminfraconfig.workers | Medplum](/content/docs/sdk/core-medpluminfraconfig-workers.html): Home > @medplum/core > MedplumInfraConfig > workers (11 words) - [core.medpluminfraconfig.rdsproxyenabled | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsproxyenabled.html): Home > @medplum/core > MedplumInfraConfig > rdsProxyEnabled (7 words) - [core.medplumclientoptions.maxretrytime | Medplum](/content/docs/sdk/core-medplumclientoptions-maxretrytime.html): Home > @medplum/core > MedplumClientOptions > maxRetryTime (107 words) - [core.medpluminfraconfig.signingkeyid | Medplum](/content/docs/sdk/core-medpluminfraconfig-signingkeyid.html): Home > @medplum/core > MedplumInfraConfig > signingKeyId (7 words) - [core.medpluminfraconfig.mtlssslcertarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-mtlssslcertarn.html): Home > @medplum/core > MedplumInfraConfig > mtlsSslCertArn (7 words) - [core.medpluminfraconfig.rdsreaderinstancetype | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsreaderinstancetype.html): Home > @medplum/core > MedplumInfraConfig > rdsReaderInstanceType (7 words) - [core.medpluminfraconfig.rdsforceretain | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsforceretain.html): Home > @medplum/core > MedplumInfraConfig > rdsForceRetain (7 words) - [core.medpluminfraconfig.guarddutymalwareprotectionenabled | Medplum](/content/docs/sdk/core-medpluminfraconfig-guarddutymalwareprotectionenabled.html): Home > @medplum/core > MedplumInfraConfig > guardDutyMalwareProtectionEnabled (8 words) - [core.medpluminfraconfig.rdsautominorversionupgrade | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsautominorversionupgrade.html): Home > @medplum/core > MedplumInfraConfig > rdsAutoMinorVersionUpgrade (8 words) - [core.medpluminfraconfig.stackname | Medplum](/content/docs/sdk/core-medpluminfraconfig-stackname.html): Home > @medplum/core > MedplumInfraConfig > stackName (7 words) - [core.medpluminfraconfig.rdsinstances | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsinstances.html): Home > @medplum/core > MedplumInfraConfig > rdsInstances (7 words) - [core.medpluminfraconfig.rdsinstancetype | Medplum](/content/docs/sdk/core-medpluminfraconfig-rdsinstancetype.html): Home > @medplum/core > MedplumInfraConfig > rdsInstanceType (7 words) - [core.medpluminfraconfig.pubsubredis | Medplum](/content/docs/sdk/core-medpluminfraconfig-pubsubredis.html): Home > @medplum/core > MedplumInfraConfig > pubSubRedis (17 words) - [core.medpluminfraconfig.firelens | Medplum](/content/docs/sdk/core-medpluminfraconfig-firelens.html): Home > @medplum/core > MedplumInfraConfig > fireLens (41 words) - [core.medpluminfraconfig.mtlswafipsetarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-mtlswafipsetarn.html): Home > @medplum/core > MedplumInfraConfig > mtlsWafIpSetArn (7 words) - [core.medpluminfraconfig.environment | Medplum](/content/docs/sdk/core-medpluminfraconfig-environment.html): Home > @medplum/core > MedplumInfraConfig > environment (7 words) - [core.medpluminfraconfig.mtlsinternetfacing | Medplum](/content/docs/sdk/core-medpluminfraconfig-mtlsinternetfacing.html): Home > @medplum/core > MedplumInfraConfig > mtlsInternetFacing (7 words) - [core.medpluminfraconfig.clamscanloggingbucket | Medplum](/content/docs/sdk/core-medpluminfraconfig-clamscanloggingbucket.html): Home > @medplum/core > MedplumInfraConfig > clamscanLoggingBucket (17 words) - [core.medpluminfraconfig.loadbalanceralgorithm | Medplum](/content/docs/sdk/core-medpluminfraconfig-loadbalanceralgorithm.html): Home > @medplum/core > MedplumInfraConfig > loadBalancerAlgorithm (12 words) - [core.medpluminfraconfig.mtlsdomainname | Medplum](/content/docs/sdk/core-medpluminfraconfig-mtlsdomainname.html): Home > @medplum/core > MedplumInfraConfig > mtlsDomainName (8 words) - [core.medpluminfraconfig.maxazs | Medplum](/content/docs/sdk/core-medpluminfraconfig-maxazs.html): Home > @medplum/core > MedplumInfraConfig > maxAzs (8 words) - [core.medpluminfraconfig.loadbalancersecuritygroupid | Medplum](/content/docs/sdk/core-medpluminfraconfig-loadbalancersecuritygroupid.html): Home > @medplum/core > MedplumInfraConfig > loadBalancerSecurityGroupId (7 words) - [core.medpluminfraconfig.fargateautoscaling | Medplum](/content/docs/sdk/core-medpluminfraconfig-fargateautoscaling.html): Home > @medplum/core > MedplumInfraConfig > fargateAutoScaling (18 words) - [core.medpluminfraconfig.loadbalancerloggingprefix | Medplum](/content/docs/sdk/core-medpluminfraconfig-loadbalancerloggingprefix.html): Home > @medplum/core > MedplumInfraConfig > loadBalancerLoggingPrefix (7 words) - [core.medplumclient.sendemail | Medplum](/content/docs/sdk/core-medplumclient-sendemail.html): Home > @medplum/core > MedplumClient > sendEmail (104 words) - [core.medpluminfraconfig.domainname | Medplum](/content/docs/sdk/core-medpluminfraconfig-domainname.html): Home > @medplum/core > MedplumInfraConfig > domainName (8 words) - [core.medpluminfraconfig.cacheengineversion | Medplum](/content/docs/sdk/core-medpluminfraconfig-cacheengineversion.html): Home > @medplum/core > MedplumInfraConfig > cacheEngineVersion (8 words) - [core.medpluminfraconfig.containerinsightsv2 | Medplum](/content/docs/sdk/core-medpluminfraconfig-containerinsightsv2.html): Home > @medplum/core > MedplumInfraConfig > containerInsightsV2 (12 words) - [core.medpluminfraconfig.clamscanenabled | Medplum](/content/docs/sdk/core-medpluminfraconfig-clamscanenabled.html): Home > @medplum/core > MedplumInfraConfig > clamscanEnabled (16 words) - [core.medpluminfraconfig.desiredservercount | Medplum](/content/docs/sdk/core-medpluminfraconfig-desiredservercount.html): Home > @medplum/core > MedplumInfraConfig > desiredServerCount (8 words) - [core.medplumclient.subscribetocriteria | Medplum](/content/docs/sdk/core-medplumclient-subscribetocriteria.html): Home > @medplum/core > MedplumClient > subscribeToCriteria (154 words) - [core.medplumclient.search | Medplum](/content/docs/sdk/core-medplumclient-search.html): Home > @medplum/core > MedplumClient > search (141 words) - [core.medpluminfraconfig.containerregistrycredentialssecretarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-containerregistrycredentialssecretarn.html): Home > @medplum/core > MedplumInfraConfig > containerRegistryCredentialsSecretArn (7 words) - [core.medplumclient.uploadmedia | Medplum](/content/docs/sdk/core-medplumclient-uploadmedia.html): Home > @medplum/core > MedplumClient > uploadMedia (125 words) - [core.medplumclient.updateresource | Medplum](/content/docs/sdk/core-medplumclient-updateresource.html): Home > @medplum/core > MedplumClient > updateResource (85 words) - [core.medplumclientoptions.resourcecachesize | Medplum](/content/docs/sdk/core-medplumclientoptions-resourcecachesize.html): Home > @medplum/core > MedplumClientOptions > resourceCacheSize (30 words) - [core.medpluminfraconfig.backgroundjobsredis | Medplum](/content/docs/sdk/core-medpluminfraconfig-backgroundjobsredis.html): Home > @medplum/core > MedplumInfraConfig > backgroundJobsRedis (17 words) - [core.medplumclientoptions.storage | Medplum](/content/docs/sdk/core-medplumclientoptions-storage.html): Home > @medplum/core > MedplumClientOptions > storage (72 words) - [core.medpluminfraconfig.cachenodetype | Medplum](/content/docs/sdk/core-medpluminfraconfig-cachenodetype.html): Home > @medplum/core > MedplumInfraConfig > cacheNodeType (8 words) - [core.medpluminfraconfig.apploggingprefix | Medplum](/content/docs/sdk/core-medpluminfraconfig-apploggingprefix.html): Home > @medplum/core > MedplumInfraConfig > appLoggingPrefix (8 words) - [core.medpluminfraconfig.cacheengine | Medplum](/content/docs/sdk/core-medpluminfraconfig-cacheengine.html): Home > @medplum/core > MedplumInfraConfig > cacheEngine (7 words) - [core.medpluminfraconfig.appwafipsetarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-appwafipsetarn.html): Home > @medplum/core > MedplumInfraConfig > appWafIpSetArn (8 words) - [core.medplumclient.startnewproject | Medplum](/content/docs/sdk/core-medplumclient-startnewproject.html): Home > @medplum/core > MedplumClient > startNewProject (52 words) - [core.medplumclient.startjwtbearerlogin | Medplum](/content/docs/sdk/core-medplumclient-startjwtbearerlogin.html): Home > @medplum/core > MedplumClient > startJwtBearerLogin (66 words) - [core.medpluminfraconfig.apiwafipsetarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-apiwafipsetarn.html): Home > @medplum/core > MedplumInfraConfig > apiWafIpSetArn (8 words) - [core.medplumclientoptions.fhircasthuburl | Medplum](/content/docs/sdk/core-medplumclientoptions-fhircasthuburl.html): Home > @medplum/core > MedplumClientOptions > fhircastHubUrl (40 words) - [core.medplumclient.searchresources | Medplum](/content/docs/sdk/core-medplumclient-searchresources.html): Home > @medplum/core > MedplumClient > searchResources (118 words) - [core.medplumclientoptions.extendedmode | Medplum](/content/docs/sdk/core-medplumclientoptions-extendedmode.html): Home > @medplum/core > MedplumClientOptions > extendedMode (34 words) - [core.medpluminfraconfig.cachesecuritygroupid | Medplum](/content/docs/sdk/core-medpluminfraconfig-cachesecuritygroupid.html): Home > @medplum/core > MedplumInfraConfig > cacheSecurityGroupId (7 words) - [core.medplumclientoptions.autobatchtime | Medplum](/content/docs/sdk/core-medplumclientoptions-autobatchtime.html): Home > @medplum/core > MedplumClientOptions > autoBatchTime (46 words) - [core.medpluminfraconfig.appsslcertarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-appsslcertarn.html): Home > @medplum/core > MedplumInfraConfig > appSslCertArn (8 words) - [core.medpluminfraconfig.apploggingbucket | Medplum](/content/docs/sdk/core-medpluminfraconfig-apploggingbucket.html): Home > @medplum/core > MedplumInfraConfig > appLoggingBucket (7 words) - [core.medplumclientoptions.redirect | Medplum](/content/docs/sdk/core-medplumclientoptions-redirect.html): Home > @medplum/core > MedplumClientOptions > redirect (26 words) - [core.medplumclient.startnewuser | Medplum](/content/docs/sdk/core-medplumclient-startnewuser.html): Home > @medplum/core > MedplumClient > startNewUser (61 words) - [core.medplumclientoptions.verbose | Medplum](/content/docs/sdk/core-medplumclientoptions-verbose.html): Home > @medplum/core > MedplumClientOptions > verbose (41 words) - [core.medplumclient.wrappedfetch | Medplum](/content/docs/sdk/core-medplumclient-wrappedfetch.html): Home > @medplum/core > MedplumClient > wrappedFetch (41 words) - [core.medplumclientoptions.authorizeurl | Medplum](/content/docs/sdk/core-medplumclientoptions-authorizeurl.html): Home > @medplum/core > MedplumClientOptions > authorizeUrl (43 words) - [core.medplumclientoptions.maxretries | Medplum](/content/docs/sdk/core-medplumclientoptions-maxretries.html): Home > @medplum/core > MedplumClientOptions > maxRetries (57 words) - [core.medplumclient.signinwithredirect | Medplum](/content/docs/sdk/core-medplumclient-signinwithredirect.html): Home > @medplum/core > MedplumClient > signInWithRedirect (59 words) - [core.medpluminfraconfig.appdomainname | Medplum](/content/docs/sdk/core-medpluminfraconfig-appdomainname.html): Home > @medplum/core > MedplumInfraConfig > appDomainName (8 words) - [core.medplumclient.upsertresource | Medplum](/content/docs/sdk/core-medplumclient-upsertresource.html): Home > @medplum/core > MedplumClient > upsertResource (82 words) - [core.medplumclienteventmap | Medplum](/content/docs/sdk/core-medplumclienteventmap.html): Home > @medplum/core > MedplumClientEventMap (73 words) - [core.medplumclient.valuesetexpand | Medplum](/content/docs/sdk/core-medplumclient-valuesetexpand.html): Home > @medplum/core > MedplumClient > valueSetExpand (45 words) - [core.medplumclientoptions.logouturl | Medplum](/content/docs/sdk/core-medplumclientoptions-logouturl.html): Home > @medplum/core > MedplumClientOptions > logoutUrl (41 words) - [core.medplumclientoptions.tokenurl | Medplum](/content/docs/sdk/core-medplumclientoptions-tokenurl.html): Home > @medplum/core > MedplumClientOptions > tokenUrl (37 words) - [core.medplumclient | Medplum](/content/docs/sdk/core-medplumclient.html): Home > @medplum/core > MedplumClient (300 words) - [core.medpluminfraconfig.additionalcontainers | Medplum](/content/docs/sdk/core-medpluminfraconfig-additionalcontainers.html): Home > @medplum/core > MedplumInfraConfig > additionalContainers (26 words) - [core.medpluminfraconfig.apisslcertarn | Medplum](/content/docs/sdk/core-medpluminfraconfig-apisslcertarn.html): Home > @medplum/core > MedplumInfraConfig > apiSslCertArn (7 words) - [core.medplumclientoptions.fhirurlpath | Medplum](/content/docs/sdk/core-medplumclientoptions-fhirurlpath.html): Home > @medplum/core > MedplumClientOptions > fhirUrlPath (41 words) - [core.medplumclient.readversion | Medplum](/content/docs/sdk/core-medplumclient-readversion.html): Home > @medplum/core > MedplumClient > readVersion (81 words) - [core.medplumclient.uploadwithprogress | Medplum](/content/docs/sdk/core-medplumclient-uploadwithprogress.html): Home > @medplum/core > MedplumClient > uploadwithProgress (40 words) - [core.medpluminfraconfig.appapiproxy | Medplum](/content/docs/sdk/core-medpluminfraconfig-appapiproxy.html): Home > @medplum/core > MedplumInfraConfig > appApiProxy (7 words) - [core.medplumclientoptions.refreshgraceperiod | Medplum](/content/docs/sdk/core-medplumclientoptions-refreshgraceperiod.html): Home > @medplum/core > MedplumClientOptions > refreshGracePeriod (39 words) - [core.medpluminfraconfig.accountnumber | Medplum](/content/docs/sdk/core-medpluminfraconfig-accountnumber.html): Home > @medplum/core > MedplumInfraConfig > accountNumber (8 words) - [core.medplumclientoptions.onunauthenticated | Medplum](/content/docs/sdk/core-medplumclientoptions-onunauthenticated.html): Home > @medplum/core > MedplumClientOptions > onUnauthenticated (32 words) - [core.medplumclientoptions.cdsservicesurl | Medplum](/content/docs/sdk/core-medplumclientoptions-cdsservicesurl.html): Home > @medplum/core > MedplumClientOptions > cdsServicesUrl (43 words) - [core.medpluminfraconfig.apidomainname | Medplum](/content/docs/sdk/core-medpluminfraconfig-apidomainname.html): Home > @medplum/core > MedplumInfraConfig > apiDomainName (7 words) - [core.medplumclientoptions.fetch | Medplum](/content/docs/sdk/core-medplumclientoptions-fetch.html): Home > @medplum/core > MedplumClientOptions > fetch (20 words) - [core.medplumclientoptions.loglevel | Medplum](/content/docs/sdk/core-medplumclientoptions-loglevel.html): Home > @medplum/core > MedplumClientOptions > logLevel (41 words) - [core.medplumclient.startnewpatient | Medplum](/content/docs/sdk/core-medplumclient-startnewpatient.html): Home > @medplum/core > MedplumClient > startNewPatient (54 words) - [core.medplumclientoptions.clientsecret | Medplum](/content/docs/sdk/core-medplumclientoptions-clientsecret.html): Home > @medplum/core > MedplumClientOptions > clientSecret (21 words) - [core.medpluminfraconfig.apiport | Medplum](/content/docs/sdk/core-medpluminfraconfig-apiport.html): Home > @medplum/core > MedplumInfraConfig > apiPort (7 words) - [core.medplumclientoptions.authcredentialsmethod | Medplum](/content/docs/sdk/core-medplumclientoptions-authcredentialsmethod.html): Home > @medplum/core > MedplumClientOptions > authCredentialsMethod (38 words) - [core.medicationorderrequest | Medplum](/content/docs/sdk/core-medicationorderrequest.html): Home > @medplum/core > MedicationOrderRequest (174 words) - [core.medplumclientoptions.cachetime | Medplum](/content/docs/sdk/core-medplumclientoptions-cachetime.html): Home > @medplum/core > MedplumClientOptions > cacheTime (51 words) - [core.medplumclient.startjwtassertionlogin | Medplum](/content/docs/sdk/core-medplumclient-startjwtassertionlogin.html): Home > @medplum/core > MedplumClient > startJwtAssertionLogin (46 words) - [core.medplumclient.setbasicauth | Medplum](/content/docs/sdk/core-medplumclient-setbasicauth.html): Home > @medplum/core > MedplumClient > setBasicAuth (45 words) - [core.medplumclient.startpkce | Medplum](/content/docs/sdk/core-medplumclient-startpkce.html): Home > @medplum/core > MedplumClient > startPkce (42 words) - [core.medplumclient.validateresource | Medplum](/content/docs/sdk/core-medplumclient-validateresource.html): Home > @medplum/core > MedplumClient > validateResource (64 words) - [core.medplumclient.startlogin | Medplum](/content/docs/sdk/core-medplumclient-startlogin.html): Home > @medplum/core > MedplumClient > startLogin (49 words) - [core.medplumclient.searchresourcepages | Medplum](/content/docs/sdk/core-medplumclient-searchresourcepages.html): Home > @medplum/core > MedplumClient > searchResourcePages (139 words) - [core.medplumclient.setloglevel | Medplum](/content/docs/sdk/core-medplumclient-setloglevel.html): Home > @medplum/core > MedplumClient > setLogLevel (92 words) - [core.medplumclient.startgooglelogin | Medplum](/content/docs/sdk/core-medplumclient-startgooglelogin.html): Home > @medplum/core > MedplumClient > startGoogleLogin (63 words) - [core.medplumclientoptions.clientid | Medplum](/content/docs/sdk/core-medplumclientoptions-clientid.html): Home > @medplum/core > MedplumClientOptions > clientId (18 words) - [core.medplumclientoptions.defaultheaders | Medplum](/content/docs/sdk/core-medplumclientoptions-defaultheaders.html): Home > @medplum/core > MedplumClientOptions > defaultHeaders (29 words) - [core.medplumclient.ratelimitstatus | Medplum](/content/docs/sdk/core-medplumclient-ratelimitstatus.html): Home > @medplum/core > MedplumClient > rateLimitStatus (23 words) - [core.medplumclient.startclientlogin | Medplum](/content/docs/sdk/core-medplumclient-startclientlogin.html): Home > @medplum/core > MedplumClient > startClientLogin (57 words) - [core.medplumclient.signout | Medplum](/content/docs/sdk/core-medplumclient-signout.html): Home > @medplum/core > MedplumClient > signOut (26 words) - [core.medplumclient.signoutwithredirect | Medplum](/content/docs/sdk/core-medplumclient-signoutwithredirect.html): Home > @medplum/core > MedplumClient > signOutWithRedirect (17 words) - [core.medplumclient.pushtoagent | Medplum](/content/docs/sdk/core-medplumclient-pushtoagent.html): Home > @medplum/core > MedplumClient > pushToAgent (101 words) - [core.medplumclient.searchone | Medplum](/content/docs/sdk/core-medplumclient-searchone.html): Home > @medplum/core > MedplumClient > searchOne (118 words) - [core.medplumclient.notifyresourcemodified | Medplum](/content/docs/sdk/core-medplumclient-notifyresourcemodified.html): Home > @medplum/core > MedplumClient > notifyResourceModified (124 words) - [core.medplumclient.setverbose | Medplum](/content/docs/sdk/core-medplumclient-setverbose.html): Home > @medplum/core > MedplumClient > setVerbose (71 words) - [core.medplumclient.patchresource | Medplum](/content/docs/sdk/core-medplumclient-patchresource.html): Home > @medplum/core > MedplumClient > patchResource (100 words) - [core.medplumclient.post | Medplum](/content/docs/sdk/core-medplumclient-post.html): Home > @medplum/core > MedplumClient > post (111 words) - [core.medplumclient.readpatienteverything | Medplum](/content/docs/sdk/core-medplumclient-readpatienteverything.html): Home > @medplum/core > MedplumClient > readPatientEverything (62 words) - [core.medplumclient.setaccesstoken | Medplum](/content/docs/sdk/core-medplumclient-setaccesstoken.html): Home > @medplum/core > MedplumClient > setAccessToken (35 words) - [core.medplumclient.put | Medplum](/content/docs/sdk/core-medplumclient-put.html): Home > @medplum/core > MedplumClient > put (108 words) - [core.medplumclient.createresourceifnoneexist | Medplum](/content/docs/sdk/core-medplumclient-createresourceifnoneexist.html): Home > @medplum/core > MedplumClient > createResourceIfNoneExist (154 words) - [Visits | Medplum](/content/docs/provider/visits/index.html): Visit management is at the heart of clinical documentation and patient care delivery. The Medplum Provider app provides comprehensive tools for documenting patient Visits, streamlining clinical workflows through Care Templates, and customizing documentation to meet specific practice needs. This section covers the essential Visit management functions. (2,653 words) - [core.medplumclient.readresource | Medplum](/content/docs/sdk/core-medplumclient-readresource.html): Home > @medplum/core > MedplumClient > readResource (67 words) - [core.medplumclient.readcanonical | Medplum](/content/docs/sdk/core-medplumclient-readcanonical.html): Home > @medplum/core > MedplumClient > readCanonical (39 words) - [core.medplumclient.requestschema | Medplum](/content/docs/sdk/core-medplumclient-requestschema.html): Home > @medplum/core > MedplumClient > requestSchema (56 words) - [core.medplumclient.readresourcegraph | Medplum](/content/docs/sdk/core-medplumclient-readresourcegraph.html): Home > @medplum/core > MedplumClient > readResourceGraph (74 words) - [core.medplumclient.readpatientsummary | Medplum](/content/docs/sdk/core-medplumclient-readpatientsummary.html): Home > @medplum/core > MedplumClient > readPatientSummary (69 words) - [core.medplumclient.readhistory | Medplum](/content/docs/sdk/core-medplumclient-readhistory.html): Home > @medplum/core > MedplumClient > readHistory (88 words) - [core.medplumclient.readreference | Medplum](/content/docs/sdk/core-medplumclient-readreference.html): Home > @medplum/core > MedplumClient > readReference (75 words) - [core.medplumclient.requestprofileschema | Medplum](/content/docs/sdk/core-medplumclient-requestprofileschema.html): Home > @medplum/core > MedplumClient > requestProfileSchema (49 words) - [core.medplumclient.refreshifexpired | Medplum](/content/docs/sdk/core-medplumclient-refreshifexpired.html): Home > @medplum/core > MedplumClient > refreshIfExpired (53 words) - [core.medplumclient.graphql | Medplum](/content/docs/sdk/core-medplumclient-graphql.html): Home > @medplum/core > MedplumClient > graphql (136 words) - [core.medplumclient.executebatch | Medplum](/content/docs/sdk/core-medplumclient-executebatch.html): Home > @medplum/core > MedplumClient > executeBatch (126 words) - [core.medplumclient.isinitialized | Medplum](/content/docs/sdk/core-medplumclient-isinitialized.html): Home > @medplum/core > MedplumClient > isInitialized (9 words) - [core.medicationsearchparams | Medplum](/content/docs/sdk/core-medicationsearchparams.html): Home > @medplum/core > MedicationSearchParams (120 words) - [core.medplumclient.createpdf_1 | Medplum](/content/docs/sdk/core-medplumclient-createpdf_1.html): Home > @medplum/core > MedplumClient > createPdf (86 words) - [core.medplumclient.fhircastpublish | Medplum](/content/docs/sdk/core-medplumclient-fhircastpublish.html): Home > @medplum/core > MedplumClient > fhircastPublish (109 words) - [core.medplumclient.processcode | Medplum](/content/docs/sdk/core-medplumclient-processcode.html): Home > @medplum/core > MedplumClient > processCode (41 words) - [core.medplumclient.requestcache | Medplum](/content/docs/sdk/core-medplumclient-requestcache.html): Home > @medplum/core > MedplumClient > requestCache (11 words) - [core.medplumclient.fhirsearchurl | Medplum](/content/docs/sdk/core-medplumclient-fhirsearchurl.html): Home > @medplum/core > MedplumClient > fhirSearchUrl (61 words) - [core.medplumclient.invalidateurl | Medplum](/content/docs/sdk/core-medplumclient-invalidateurl.html): Home > @medplum/core > MedplumClient > invalidateUrl (42 words) - [core.medplumclient.createpdf | Medplum](/content/docs/sdk/core-medplumclient-createpdf.html): Home > @medplum/core > MedplumClient > createPdf (108 words) - [core.medplumclient.isauthenticated | Medplum](/content/docs/sdk/core-medplumclient-isauthenticated.html): Home > @medplum/core > MedplumClient > isAuthenticated (67 words) - [core.medplumclient.fhircastunsubscribe | Medplum](/content/docs/sdk/core-medplumclient-fhircastunsubscribe.html): Home > @medplum/core > MedplumClient > fhircastUnsubscribe (52 words) - [core.medplumclient.getprofileasync | Medplum](/content/docs/sdk/core-medplumclient-getprofileasync.html): Home > @medplum/core > MedplumClient > getProfileAsync (41 words) - [core.medplumclient.getmastersubscriptionemitter | Medplum](/content/docs/sdk/core-medplumclient-getmastersubscriptionemitter.html): Home > @medplum/core > MedplumClient > getMasterSubscriptionEmitter (73 words) - [core.medplumclient.createresource | Medplum](/content/docs/sdk/core-medplumclient-createresource.html): Home > @medplum/core > MedplumClient > createResource (96 words) - [core.medplumclient.getlogins | Medplum](/content/docs/sdk/core-medplumclient-getlogins.html): Home > @medplum/core > MedplumClient > getLogins (21 words) - [core.medplumclient.invite | Medplum](/content/docs/sdk/core-medplumclient-invite.html): Home > @medplum/core > MedplumClient > invite (48 words) - [core.medplumclient.gettokenurl | Medplum](/content/docs/sdk/core-medplumclient-gettokenurl.html): Home > @medplum/core > MedplumClient > getTokenUrl (38 words) - [core.medplumclient.isprojectadmin | Medplum](/content/docs/sdk/core-medplumclient-isprojectadmin.html): Home > @medplum/core > MedplumClient > isProjectAdmin (30 words) - [core.medplumclient.fhircastgetcontext | Medplum](/content/docs/sdk/core-medplumclient-fhircastgetcontext.html): Home > @medplum/core > MedplumClient > fhircastGetContext (50 words) - [core.medplumclient.bulkexport | Medplum](/content/docs/sdk/core-medplumclient-bulkexport.html): Home > @medplum/core > MedplumClient > bulkExport (117 words) - [core.medplumclient.getsubscriptionmanager | Medplum](/content/docs/sdk/core-medplumclient-getsubscriptionmanager.html): Home > @medplum/core > MedplumClient > getSubscriptionManager (19 words) - [core.medicationorderdruginput | Medplum](/content/docs/sdk/core-medicationorderdruginput.html): Home > @medplum/core > MedicationOrderDrugInput (193 words) - [core.medplumclient.keyvalue | Medplum](/content/docs/sdk/core-medplumclient-keyvalue.html): Home > @medplum/core > MedplumClient > keyValue (14 words) - [core.medplumclient.createdocumentreference | Medplum](/content/docs/sdk/core-medplumclient-createdocumentreference.html): Home > @medplum/core > MedplumClient > createDocumentReference (56 words) - [core.medplumclient.callcdsservice | Medplum](/content/docs/sdk/core-medplumclient-callcdsservice.html): Home > @medplum/core > MedplumClient > callCdsService (51 words) - [core.medplumclient.download | Medplum](/content/docs/sdk/core-medplumclient-download.html): Home > @medplum/core > MedplumClient > download (74 words) - [core.medplumclient.getlogouturl | Medplum](/content/docs/sdk/core-medplumclient-getlogouturl.html): Home > @medplum/core > MedplumClient > getLogoutUrl (38 words) - [core.medplumclient.createbinary_1 | Medplum](/content/docs/sdk/core-medplumclient-createbinary_1.html): Home > @medplum/core > MedplumClient > createBinary (111 words) - [core.medplumclient.invalidatesearches | Medplum](/content/docs/sdk/core-medplumclient-invalidatesearches.html): Home > @medplum/core > MedplumClient > invalidateSearches (34 words) - [core.medplumclient.isloading | Medplum](/content/docs/sdk/core-medplumclient-isloading.html): Home > @medplum/core > MedplumClient > isLoading (29 words) - [core.medplumclient.getexternalauthredirecturi | Medplum](/content/docs/sdk/core-medplumclient-getexternalauthredirecturi.html): Home > @medplum/core > MedplumClient > getExternalAuthRedirectUri (78 words) - [core.medplumclient.getcached | Medplum](/content/docs/sdk/core-medplumclient-getcached.html): Home > @medplum/core > MedplumClient > getCached (60 words) - [core.medplumclient.issuperadmin | Medplum](/content/docs/sdk/core-medplumclient-issuperadmin.html): Home > @medplum/core > MedplumClient > isSuperAdmin (32 words) - [core.medplumclient.getfhircasthuburl | Medplum](/content/docs/sdk/core-medplumclient-getfhircasthuburl.html): Home > @medplum/core > MedplumClient > getFhircastHubUrl (41 words) - [core.medplumclient.createattachment_1 | Medplum](/content/docs/sdk/core-medplumclient-createattachment_1.html): Home > @medplum/core > MedplumClient > createAttachment (112 words) - [core.medplumclient.getinitpromise | Medplum](/content/docs/sdk/core-medplumclient-getinitpromise.html): Home > @medplum/core > MedplumClient > getInitPromise (47 words) - [core.medplumclient.executebot | Medplum](/content/docs/sdk/core-medplumclient-executebot.html): Home > @medplum/core > MedplumClient > executeBot (80 words) - [core.medplumclient.invalidateall | Medplum](/content/docs/sdk/core-medplumclient-invalidateall.html): Home > @medplum/core > MedplumClient > invalidateAll (18 words) - [core.medplumclient.getloglevel | Medplum](/content/docs/sdk/core-medplumclient-getloglevel.html): Home > @medplum/core > MedplumClient > getLogLevel (18 words) - [core.medplumclient.getbaseurl | Medplum](/content/docs/sdk/core-medplumclient-getbaseurl.html): Home > @medplum/core > MedplumClient > getBaseUrl (46 words) - [core.medplumclient.getprofile | Medplum](/content/docs/sdk/core-medplumclient-getprofile.html): Home > @medplum/core > MedplumClient > getProfile (35 words) - [core.medplumclient.fhircastsubscribe | Medplum](/content/docs/sdk/core-medplumclient-fhircastsubscribe.html): Home > @medplum/core > MedplumClient > fhircastSubscribe (80 words) - [core.medplumclient.getuserconfiguration | Medplum](/content/docs/sdk/core-medplumclient-getuserconfiguration.html): Home > @medplum/core > MedplumClient > getUserConfiguration (26 words) - [core.medplumclient.fhircastpublish_1 | Medplum](/content/docs/sdk/core-medplumclient-fhircastpublish_1.html): Home > @medplum/core > MedplumClient > fhircastPublish (38 words) - [core.medplumclient.getcdsservicesurl | Medplum](/content/docs/sdk/core-medplumclient-getcdsservicesurl.html): Home > @medplum/core > MedplumClient > getCdsServicesUrl (40 words) - [core.medplumclient.getprojectmembership | Medplum](/content/docs/sdk/core-medplumclient-getprojectmembership.html): Home > @medplum/core > MedplumClient > getProjectMembership (26 words) - [core.medplumclient.getproject | Medplum](/content/docs/sdk/core-medplumclient-getproject.html): Home > @medplum/core > MedplumClient > getProject (24 words) - [core.medplumclient.createmedia | Medplum](/content/docs/sdk/core-medplumclient-createmedia.html): Home > @medplum/core > MedplumClient > createMedia (54 words) - [core.medplumclient.exchangeexternalaccesstoken | Medplum](/content/docs/sdk/core-medplumclient-exchangeexternalaccesstoken.html): Home > @medplum/core > MedplumClient > exchangeExternalAccessToken (77 words) - [core.medplumclient.deleteresource | Medplum](/content/docs/sdk/core-medplumclient-deleteresource.html): Home > @medplum/core > MedplumClient > deleteResource (61 words) - [core.medplumclient.getcdsservices | Medplum](/content/docs/sdk/core-medplumclient-getcdsservices.html): Home > @medplum/core > MedplumClient > getCdsServices (32 words) - [core.medplumclient.createcomment | Medplum](/content/docs/sdk/core-medplumclient-createcomment.html): Home > @medplum/core > MedplumClient > createComment (82 words) - [core.medplumclient.getdefaultheaders | Medplum](/content/docs/sdk/core-medplumclient-getdefaultheaders.html): Home > @medplum/core > MedplumClient > getDefaultHeaders (41 words) - [core.medplumclient.fhirurl | Medplum](/content/docs/sdk/core-medplumclient-fhirurl.html): Home > @medplum/core > MedplumClient > fhirUrl (41 words) - [core.medplumclient.getauthorizeurl | Medplum](/content/docs/sdk/core-medplumclient-getauthorizeurl.html): Home > @medplum/core > MedplumClient > getAuthorizeUrl (38 words) - [core.medplumclient.get | Medplum](/content/docs/sdk/core-medplumclient-get.html): Home > @medplum/core > MedplumClient > get (68 words) - [core.medplumclient.fhircastconnect | Medplum](/content/docs/sdk/core-medplumclient-fhircastconnect.html): Home > @medplum/core > MedplumClient > fhircastConnect (39 words) - [core.medplumclient.getcachedreference | Medplum](/content/docs/sdk/core-medplumclient-getcachedreference.html): Home > @medplum/core > MedplumClient > getCachedReference (42 words) - [core.medplumclient.createbinary | Medplum](/content/docs/sdk/core-medplumclient-createbinary.html): Home > @medplum/core > MedplumClient > createBinary (109 words) - [core.medplumclient.getaccesspolicy | Medplum](/content/docs/sdk/core-medplumclient-getaccesspolicy.html): Home > @medplum/core > MedplumClient > getAccessPolicy (28 words) - [core.medplumclient.ensurecodechallenge | Medplum](/content/docs/sdk/core-medplumclient-ensurecodechallenge.html): Home > @medplum/core > MedplumClient > ensureCodeChallenge (56 words) - [core.medicationordersetresponse | Medplum](/content/docs/sdk/core-medicationordersetresponse.html): Home > @medplum/core > MedicationOrderSetResponse (84 words) - [core.medplumclient.getactivelogin | Medplum](/content/docs/sdk/core-medplumclient-getactivelogin.html): Home > @medplum/core > MedplumClient > getActiveLogin (16 words) - [core.medplumclient.createattachment | Medplum](/content/docs/sdk/core-medplumclient-createattachment.html): Home > @medplum/core > MedplumClient > createAttachment (110 words) - [core.medplumclient.getaccesstoken | Medplum](/content/docs/sdk/core-medplumclient-getaccesstoken.html): Home > @medplum/core > MedplumClient > getAccessToken (22 words) - [core.medplumclient.downloadresponse | Medplum](/content/docs/sdk/core-medplumclient-downloadresponse.html): Home > @medplum/core > MedplumClient > downloadResponse (69 words) - [core.medicationsearchparamstoparameters | Medplum](/content/docs/sdk/core-medicationsearchparamstoparameters.html): Home > @medplum/core > medicationSearchParamsToParameters (75 words) - [core.medplum_releases_url | Medplum](/content/docs/sdk/core-medplum_releases_url.html): Home > @medplum/core > MEDPLUM\RELEASES\URL (8 words) - [core.medplumclient.delete | Medplum](/content/docs/sdk/core-medplumclient-delete.html): Home > @medplum/core > MedplumClient > delete (64 words) - [core.medicationsearchparams.searchsupply | Medplum](/content/docs/sdk/core-medicationsearchparams-searchsupply.html): Home > @medplum/core > MedicationSearchParams > searchSupply (9 words) - [core.medicationordersetresponse.launchurl | Medplum](/content/docs/sdk/core-medicationordersetresponse-launchurl.html): Home > @medplum/core > MedicationOrderSetResponse > launchUrl (9 words) - [core.medicationsearchparams.rxnorm | Medplum](/content/docs/sdk/core-medicationsearchparams-rxnorm.html): Home > @medplum/core > MedicationSearchParams > rxNorm (9 words) - [core.medplumclient.clear | Medplum](/content/docs/sdk/core-medplumclient-clear.html): Home > @medplum/core > MedplumClient > clear (20 words) - [core.medplum_semver_regex | Medplum](/content/docs/sdk/core-medplum_semver_regex.html): Home > @medplum/core > MEDPLUM\SEMVER\REGEX (7 words) - [core.medicationordersetrequest.vendorordersetid | Medplum](/content/docs/sdk/core-medicationordersetrequest-vendorordersetid.html): Home > @medplum/core > MedicationOrderSetRequest > vendorOrderSetId (41 words) - [core.medplumclient._constructor_ | Medplum](/content/docs/sdk/core-medplumclient-_constructor_.html): Home > @medplum/core > MedplumClient > (constructor) (19 words) - [core.medplumclient.clearactivelogin | Medplum](/content/docs/sdk/core-medplumclient-clearactivelogin.html): Home > @medplum/core > MedplumClient > clearActiveLogin (26 words) - [core.medicationordersetrequesttoparameters | Medplum](/content/docs/sdk/core-medicationordersetrequesttoparameters.html): Home > @medplum/core > medicationOrderSetRequestToParameters (91 words) - [core.medplum_version | Medplum](/content/docs/sdk/core-medplum_version.html): Home > @medplum/core > MEDPLUM\VERSION (7 words) - [core.medicationordersetresponse.vendorordersetid | Medplum](/content/docs/sdk/core-medicationordersetresponse-vendorordersetid.html): Home > @medplum/core > MedicationOrderSetResponse > vendorOrderSetId (10 words) - [core.medicationordersetresponse.plandefinitionid | Medplum](/content/docs/sdk/core-medicationordersetresponse-plandefinitionid.html): Home > @medplum/core > MedicationOrderSetResponse > planDefinitionId (8 words) - [core.medicationorderresponse | Medplum](/content/docs/sdk/core-medicationorderresponse.html): Home > @medplum/core > MedicationOrderResponse (72 words) - [core.medicationsearchparams.quantityqualifiers | Medplum](/content/docs/sdk/core-medicationsearchparams-quantityqualifiers.html): Home > @medplum/core > MedicationSearchParams > quantityQualifiers (20 words) - [core.medicationorderrequesttoparameters | Medplum](/content/docs/sdk/core-medicationorderrequesttoparameters.html): Home > @medplum/core > medicationOrderRequestToParameters (78 words) - [core.medicationsearchparams.searchotc | Medplum](/content/docs/sdk/core-medicationsearchparams-searchotc.html): Home > @medplum/core > MedicationSearchParams > searchOtc (9 words) - [core.medicationorderdruginput.sigline3 | Medplum](/content/docs/sdk/core-medicationorderdruginput-sigline3.html): Home > @medplum/core > MedicationOrderDrugInput > sigLine3 (8 words) - [core.medicationcheckoutitemresult | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult.html): Home > @medplum/core > MedicationCheckoutItemResult (131 words) - [core.medicationsearchparams.searchbrand | Medplum](/content/docs/sdk/core-medicationsearchparams-searchbrand.html): Home > @medplum/core > MedicationSearchParams > searchBrand (9 words) - [core.medicationorderrequest.patientid | Medplum](/content/docs/sdk/core-medicationorderrequest-patientid.html): Home > @medplum/core > MedicationOrderRequest > patientId (9 words) - [core.medicationsearchparams.searchgeneric | Medplum](/content/docs/sdk/core-medicationsearchparams-searchgeneric.html): Home > @medplum/core > MedicationSearchParams > searchGeneric (8 words) - [core.medicationorderresponse.medicationrequestid | Medplum](/content/docs/sdk/core-medicationorderresponse-medicationrequestid.html): Home > @medplum/core > MedicationOrderResponse > medicationRequestId (8 words) - [core.medplum_cli_client_id | Medplum](/content/docs/sdk/core-medplum_cli_client_id.html): Home > @medplum/core > MEDPLUM\CLI\CLIENT\ID (6 words) - [core.medicationorderresponse.vendorpatientid | Medplum](/content/docs/sdk/core-medicationorderresponse-vendorpatientid.html): Home > @medplum/core > MedicationOrderResponse > vendorPatientId (34 words) - [core.medicationsearchparams.term | Medplum](/content/docs/sdk/core-medicationsearchparams-term.html): Home > @medplum/core > MedicationSearchParams > term (9 words) - [core.medicationsearchparams.ndc | Medplum](/content/docs/sdk/core-medicationsearchparams-ndc.html): Home > @medplum/core > MedicationSearchParams > ndc (8 words) - [core.medicationsearchparams.gcnseqnos | Medplum](/content/docs/sdk/core-medicationsearchparams-gcnseqnos.html): Home > @medplum/core > MedicationSearchParams > gcnSeqnos (45 words) - [core.medicationsearchparams.routedmedid | Medplum](/content/docs/sdk/core-medicationsearchparams-routedmedid.html): Home > @medplum/core > MedicationSearchParams > routedMedId (8 words) - [core.medicationordersetrequest.plandefinitionid | Medplum](/content/docs/sdk/core-medicationordersetrequest-plandefinitionid.html): Home > @medplum/core > MedicationOrderSetRequest > planDefinitionId (9 words) - [core.medicationsearchparams.includecode | Medplum](/content/docs/sdk/core-medicationsearchparams-includecode.html): Home > @medplum/core > MedicationSearchParams > includeCode (8 words) - [core.mailoptions | Medplum](/content/docs/sdk/core-mailoptions.html): Home > @medplum/core > MailOptions (178 words) - [core.medicationcheckoutresponse | Medplum](/content/docs/sdk/core-medicationcheckoutresponse.html): Home > @medplum/core > MedicationCheckoutResponse (50 words) - [core.medicationorderresponse.orderid | Medplum](/content/docs/sdk/core-medicationorderresponse-orderid.html): Home > @medplum/core > MedicationOrderResponse > orderId (9 words) - [core.medicationordersetresponse.vendorpatientid | Medplum](/content/docs/sdk/core-medicationordersetresponse-vendorpatientid.html): Home > @medplum/core > MedicationOrderSetResponse > vendorPatientId (10 words) - [core.medicationorderextensions | Medplum](/content/docs/sdk/core-medicationorderextensions.html): Home > @medplum/core > MedicationOrderExtensions (97 words) - [core.medicationorderrequest.compoundquantity | Medplum](/content/docs/sdk/core-medicationorderrequest-compoundquantity.html): Home > @medplum/core > MedicationOrderRequest > compoundQuantity (14 words) - [core.medicationordersetrequest.organization | Medplum](/content/docs/sdk/core-medicationordersetrequest-organization.html): Home > @medplum/core > MedicationOrderSetRequest > organization (14 words) - [core.medicationordersetrequest.patientid | Medplum](/content/docs/sdk/core-medicationordersetrequest-patientid.html): Home > @medplum/core > MedicationOrderSetRequest > patientId (8 words) - [core.medicationorderresponse.launchurl | Medplum](/content/docs/sdk/core-medicationorderresponse-launchurl.html): Home > @medplum/core > MedicationOrderResponse > launchUrl (8 words) - [core.medicationorderresponse.pendingorderstatus | Medplum](/content/docs/sdk/core-medicationorderresponse-pendingorderstatus.html): Home > @medplum/core > MedicationOrderResponse > pendingOrderStatus (11 words) - [core.medicationordersetrequest.appid | Medplum](/content/docs/sdk/core-medicationordersetrequest-appid.html): Home > @medplum/core > MedicationOrderSetRequest > appId (8 words) - [core.medicationcartitemresult.status | Medplum](/content/docs/sdk/core-medicationcartitemresult-status.html): Home > @medplum/core > MedicationCartItemResult > status (13 words) - [core.medicationorderextensions.messageidsystem | Medplum](/content/docs/sdk/core-medicationorderextensions-messageidsystem.html): Home > @medplum/core > MedicationOrderExtensions > messageIdSystem (60 words) - [core.medicationorderrequest.pharmacynote | Medplum](/content/docs/sdk/core-medicationorderrequest-pharmacynote.html): Home > @medplum/core > MedicationOrderRequest > pharmacyNote (22 words) - [core.medicationorderextensions.pendingorderstatusurl | Medplum](/content/docs/sdk/core-medicationorderextensions-pendingorderstatusurl.html): Home > @medplum/core > MedicationOrderExtensions > pendingOrderStatusUrl (9 words) - [core.medicationorderdruginput.gcnseqno | Medplum](/content/docs/sdk/core-medicationorderdruginput-gcnseqno.html): Home > @medplum/core > MedicationOrderDrugInput > gcnSeqno (62 words) - [core.medicationorderrequest.payerorganizationid | Medplum](/content/docs/sdk/core-medicationorderrequest-payerorganizationid.html): Home > @medplum/core > MedicationOrderRequest > payerOrganizationId (9 words) - [core.medicationorderdruginput.ndc | Medplum](/content/docs/sdk/core-medicationorderdruginput-ndc.html): Home > @medplum/core > MedicationOrderDrugInput > ndc (8 words) - [core.medicationorderrequest.pharmacyname | Medplum](/content/docs/sdk/core-medicationorderrequest-pharmacyname.html): Home > @medplum/core > MedicationOrderRequest > pharmacyName (9 words) - [core.medicationcartremoverequesttoparameters | Medplum](/content/docs/sdk/core-medicationcartremoverequesttoparameters.html): Home > @medplum/core > medicationCartRemoveRequestToParameters (55 words) - [core.medicationorderdruginput.usesubstitution | Medplum](/content/docs/sdk/core-medicationorderdruginput-usesubstitution.html): Home > @medplum/core > MedicationOrderDrugInput > useSubstitution (8 words) - [core.medicationorderrequest.filldate | Medplum](/content/docs/sdk/core-medicationorderrequest-filldate.html): Home > @medplum/core > MedicationOrderRequest > fillDate (9 words) - [core.medicationorderrequest.patientinstruction | Medplum](/content/docs/sdk/core-medicationorderrequest-patientinstruction.html): Home > @medplum/core > MedicationOrderRequest > patientInstruction (21 words) - [core.medicationorderrequest.diagnoses | Medplum](/content/docs/sdk/core-medicationorderrequest-diagnoses.html): Home > @medplum/core > MedicationOrderRequest > diagnoses (15 words) - [core.medicationorderrequest.writtendate | Medplum](/content/docs/sdk/core-medicationorderrequest-writtendate.html): Home > @medplum/core > MedicationOrderRequest > writtenDate (8 words) - [core.medicationorderrequest.pharmacyorganizationid | Medplum](/content/docs/sdk/core-medicationorderrequest-pharmacyorganizationid.html): Home > @medplum/core > MedicationOrderRequest > pharmacyOrganizationId (8 words) - [core.medicationorderrequest.drugs | Medplum](/content/docs/sdk/core-medicationorderrequest-drugs.html): Home > @medplum/core > MedicationOrderRequest > drugs (8 words) - [core.medicationorderrequest.compoundsigs | Medplum](/content/docs/sdk/core-medicationorderrequest-compoundsigs.html): Home > @medplum/core > MedicationOrderRequest > compoundSigs (18 words) - [core.medicationcheckoutresponse.vendorpatientid | Medplum](/content/docs/sdk/core-medicationcheckoutresponse-vendorpatientid.html): Home > @medplum/core > MedicationCheckoutResponse > vendorPatientId (21 words) - [core.medicationorderrequest.compoundtitle | Medplum](/content/docs/sdk/core-medicationorderrequest-compoundtitle.html): Home > @medplum/core > MedicationOrderRequest > compoundTitle (9 words) - [core.medicationorderrequest.organization | Medplum](/content/docs/sdk/core-medicationorderrequest-organization.html): Home > @medplum/core > MedicationOrderRequest > organization (20 words) - [core.medicationorderrequest.coverageid | Medplum](/content/docs/sdk/core-medicationorderrequest-coverageid.html): Home > @medplum/core > MedicationOrderRequest > coverageId (9 words) - [core.medicationorderdruginput.line1 | Medplum](/content/docs/sdk/core-medicationorderdruginput-line1.html): Home > @medplum/core > MedicationOrderDrugInput > line1 (70 words) - [core.medicationorderextensions.pendingorderidsystem | Medplum](/content/docs/sdk/core-medicationorderextensions-pendingorderidsystem.html): Home > @medplum/core > MedicationOrderExtensions > pendingOrderIdSystem (14 words) - [core.medicationorderrequest.medicationrequestid | Medplum](/content/docs/sdk/core-medicationorderrequest-medicationrequestid.html): Home > @medplum/core > MedicationOrderRequest > medicationRequestId (8 words) - [core.medicationorderdruginput.refill | Medplum](/content/docs/sdk/core-medicationorderdruginput-refill.html): Home > @medplum/core > MedicationOrderDrugInput > refill (9 words) - [core.medicationcartmanageresponse | Medplum](/content/docs/sdk/core-medicationcartmanageresponse.html): Home > @medplum/core > MedicationCartManageResponse (70 words) - [core.medicationcheckoutrequest | Medplum](/content/docs/sdk/core-medicationcheckoutrequest.html): Home > @medplum/core > MedicationCheckoutRequest (52 words) - [core.medicationorderrequest.conditionids | Medplum](/content/docs/sdk/core-medicationorderrequest-conditionids.html): Home > @medplum/core > MedicationOrderRequest > conditionIds (8 words) - [core.medicationcheckoutitemresult.duplicate | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult-duplicate.html): Home > @medplum/core > MedicationCheckoutItemResult > duplicate (44 words) - [core.medicationorderrequest.appid | Medplum](/content/docs/sdk/core-medicationorderrequest-appid.html): Home > @medplum/core > MedicationOrderRequest > appId (9 words) - [core.medicationorderrequest.compoundquantityqualifier | Medplum](/content/docs/sdk/core-medicationorderrequest-compoundquantityqualifier.html): Home > @medplum/core > MedicationOrderRequest > compoundQuantityQualifier (8 words) - [core.medicationcartremoverequest | Medplum](/content/docs/sdk/core-medicationcartremoverequest.html): Home > @medplum/core > MedicationCartRemoveRequest (45 words) - [core.medicationcheckoutitemresult.error | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult-error.html): Home > @medplum/core > MedicationCheckoutItemResult > error (8 words) - [core.medicationcheckoutitemresult.vendorlineid | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult-vendorlineid.html): Home > @medplum/core > MedicationCheckoutItemResult > vendorLineId (54 words) - [core.medicationcheckoutrequest.organization | Medplum](/content/docs/sdk/core-medicationcheckoutrequest-organization.html): Home > @medplum/core > MedicationCheckoutRequest > organization (21 words) - [core.medicationorderdruginput.drugname | Medplum](/content/docs/sdk/core-medicationorderdruginput-drugname.html): Home > @medplum/core > MedicationOrderDrugInput > drugName (21 words) - [core.medicationorderdruginput.quantityqualifier | Medplum](/content/docs/sdk/core-medicationorderdruginput-quantityqualifier.html): Home > @medplum/core > MedicationOrderDrugInput > quantityQualifier (9 words) - [core.medicationorderextensions.iframeurlextension | Medplum](/content/docs/sdk/core-medicationorderextensions-iframeurlextension.html): Home > @medplum/core > MedicationOrderExtensions > iframeUrlExtension (8 words) - [core.medicationorderdruginput.drugorder | Medplum](/content/docs/sdk/core-medicationorderdruginput-drugorder.html): Home > @medplum/core > MedicationOrderDrugInput > drugOrder (9 words) - [core.medicationcheckoutrequest.appid | Medplum](/content/docs/sdk/core-medicationcheckoutrequest-appid.html): Home > @medplum/core > MedicationCheckoutRequest > appId (8 words) - [core.medicationcheckoutrequest.medicationrequestids | Medplum](/content/docs/sdk/core-medicationcheckoutrequest-medicationrequestids.html): Home > @medplum/core > MedicationCheckoutRequest > medicationRequestIds (9 words) - [core.medicationcheckoutresponse.approvalurl | Medplum](/content/docs/sdk/core-medicationcheckoutresponse-approvalurl.html): Home > @medplum/core > MedicationCheckoutResponse > approvalUrl (8 words) - [core.inviterequest | Medplum](/content/docs/sdk/core-inviterequest.html): Home > @medplum/core > InviteRequest (88 words) - [core.matchessearchrequest | Medplum](/content/docs/sdk/core-matchessearchrequest.html): Home > @medplum/core > matchesSearchRequest (53 words) - [core.medicationcartitemresult | Medplum](/content/docs/sdk/core-medicationcartitemresult.html): Home > @medplum/core > MedicationCartItemResult (72 words) - [core.medicationcartclearrequest | Medplum](/content/docs/sdk/core-medicationcartclearrequest.html): Home > @medplum/core > MedicationCartClearRequest (24 words) - [core.mailoptions.text | Medplum](/content/docs/sdk/core-mailoptions-text.html): Home > @medplum/core > MailOptions > text (20 words) - [core.matchdiscriminant | Medplum](/content/docs/sdk/core-matchdiscriminant.html): Home > @medplum/core > matchDiscriminant (44 words) - [core.medicationcheckoutrequest.patientid | Medplum](/content/docs/sdk/core-medicationcheckoutrequest-patientid.html): Home > @medplum/core > MedicationCheckoutRequest > patientId (9 words) - [core.ismedicationordersetresponse | Medplum](/content/docs/sdk/core-ismedicationordersetresponse.html): Home > @medplum/core > isMedicationOrderSetResponse (39 words) - [core.medicationcartremoverequest.patientid | Medplum](/content/docs/sdk/core-medicationcartremoverequest-patientid.html): Home > @medplum/core > MedicationCartRemoveRequest > patientId (9 words) - [core.mailattachment | Medplum](/content/docs/sdk/core-mailattachment.html): Home > @medplum/core > MailAttachment (128 words) - [core.lrucache | Medplum](/content/docs/sdk/core-lrucache.html): Home > @medplum/core > LRUCache (80 words) - [core.medicationcheckoutitemresult.status | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult-status.html): Home > @medplum/core > MedicationCheckoutItemResult > status (11 words) - [core.mailoptions.replyto | Medplum](/content/docs/sdk/core-mailoptions-replyto.html): Home > @medplum/core > MailOptions > replyTo (21 words) - [core.medicationcheckoutitemresult.medicationrequestid | Medplum](/content/docs/sdk/core-medicationcheckoutitemresult-medicationrequestid.html): Home > @medplum/core > MedicationCheckoutItemResult > medicationRequestId (9 words) - [core.medicationcartmanageresponse.vendorpatientid | Medplum](/content/docs/sdk/core-medicationcartmanageresponse-vendorpatientid.html): Home > @medplum/core > MedicationCartManageResponse > vendorPatientId (16 words) - [core.mailoptions.cc | Medplum](/content/docs/sdk/core-mailoptions-cc.html): Home > @medplum/core > MailOptions > cc (31 words) - [core.medicationcartitemresult.medicationrequestid | Medplum](/content/docs/sdk/core-medicationcartitemresult-medicationrequestid.html): Home > @medplum/core > MedicationCartItemResult > medicationRequestId (8 words) - [core.medication_request_status_reason_response_not_received | Medplum](/content/docs/sdk/core-medication_request_status_reason_response_not_received.html): Home > @medplum/core > MEDICATION\REQUEST\STATUS\REASON\RESPONSE\NOT\RECEIVED (64 words) - [core.inviterequest.resourcetype | Medplum](/content/docs/sdk/core-inviterequest-resourcetype.html): Home > @medplum/core > InviteRequest > resourceType (12 words) - [core.medicationcartitemresult.error | Medplum](/content/docs/sdk/core-medicationcartitemresult-error.html): Home > @medplum/core > MedicationCartItemResult > error (9 words) - [core.medicationcartmanageresponse.removedcount | Medplum](/content/docs/sdk/core-medicationcartmanageresponse-removedcount.html): Home > @medplum/core > MedicationCartManageResponse > removedCount (8 words) - [core.medicationcartclearrequest.patientid | Medplum](/content/docs/sdk/core-medicationcartclearrequest-patientid.html): Home > @medplum/core > MedicationCartClearRequest > patientId (14 words) - [core.ireconnectingwebsocket | Medplum](/content/docs/sdk/core-ireconnectingwebsocket.html): Home > @medplum/core > IReconnectingWebSocket (32 words) - [core.mapbyidentifier | Medplum](/content/docs/sdk/core-mapbyidentifier.html): Home > @medplum/core > mapByIdentifier (65 words) - [core.mailoptions.from | Medplum](/content/docs/sdk/core-mailoptions-from.html): Home > @medplum/core > MailOptions > from (34 words) - [core.medicationcartmanageresponse.items | Medplum](/content/docs/sdk/core-medicationcartmanageresponse-items.html): Home > @medplum/core > MedicationCartManageResponse > items (8 words) - [core.lrucache.set | Medplum](/content/docs/sdk/core-lrucache-set.html): Home > @medplum/core > LRUCache > set (38 words) - [core.internaltypeschema | Medplum](/content/docs/sdk/core-internaltypeschema.html): Home > @medplum/core > InternalTypeSchema (66 words) - [core.ismedicationarray | Medplum](/content/docs/sdk/core-ismedicationarray.html): Home > @medplum/core > isMedicationArray (71 words) - [core.isatom.eval | Medplum](/content/docs/sdk/core-isatom-eval.html): Home > @medplum/core > IsAtom > eval (27 words) - [core.maildestination | Medplum](/content/docs/sdk/core-maildestination.html): Home > @medplum/core > MailDestination (21 words) - [core.marker.line | Medplum](/content/docs/sdk/core-marker-line.html): Home > @medplum/core > Marker > line (13 words) - [core.iscoding | Medplum](/content/docs/sdk/core-iscoding.html): Home > @medplum/core > isCoding (74 words) - [core.mailoptions.bcc | Medplum](/content/docs/sdk/core-mailoptions-bcc.html): Home > @medplum/core > MailOptions > bcc (25 words) - [core.marker.column | Medplum](/content/docs/sdk/core-marker-column.html): Home > @medplum/core > Marker > column (7 words) - [core.lrucache.get | Medplum](/content/docs/sdk/core-lrucache-get.html): Home > @medplum/core > LRUCache > get (38 words) - [core.mailoptions.attachments | Medplum](/content/docs/sdk/core-mailoptions-attachments.html): Home > @medplum/core > MailOptions > attachments (14 words) - [core.mailaddress.name | Medplum](/content/docs/sdk/core-mailaddress-name.html): Home > @medplum/core > MailAddress > name (14 words) - [core.mailattachment.path | Medplum](/content/docs/sdk/core-mailattachment-path.html): Home > @medplum/core > MailAttachment > path (42 words) - [core.mailattachment.contenttype | Medplum](/content/docs/sdk/core-mailattachment-contenttype.html): Home > @medplum/core > MailAttachment > contentType (24 words) - [core.mailattachment.filename | Medplum](/content/docs/sdk/core-mailattachment-filename.html): Home > @medplum/core > MailAttachment > filename (52 words) - [core.mailaddress | Medplum](/content/docs/sdk/core-mailaddress.html): Home > @medplum/core > MailAddress (24 words) - [core.ismedplumaccesstoken | Medplum](/content/docs/sdk/core-ismedplumaccesstoken.html): Home > @medplum/core > isMedplumAccessToken (46 words) - [core.lrucache.delete | Medplum](/content/docs/sdk/core-lrucache-delete.html): Home > @medplum/core > LRUCache > delete (28 words) - [core.isfhircastresourcetype | Medplum](/content/docs/sdk/core-isfhircastresourcetype.html): Home > @medplum/core > isFhircastResourceType (46 words) - [core.mailattachment.content | Medplum](/content/docs/sdk/core-mailattachment-content.html): Home > @medplum/core > MailAttachment > content (18 words) - [core.lrucache._constructor_ | Medplum](/content/docs/sdk/core-lrucache-_constructor_.html): Home > @medplum/core > LRUCache > (constructor) (19 words) - [core.internalschemaelement.type | Medplum](/content/docs/sdk/core-internalschemaelement-type.html): Home > @medplum/core > InternalSchemaElement > type (7 words) - [core.hl7message | Medplum](/content/docs/sdk/core-hl7message.html): Home > @medplum/core > Hl7Message (369 words) - [core.lrucache.keys | Medplum](/content/docs/sdk/core-lrucache-keys.html): Home > @medplum/core > LRUCache > keys (24 words) - [core.logmessage.level | Medplum](/content/docs/sdk/core-logmessage-level.html): Home > @medplum/core > LogMessage > level (14 words) - [core.mailaddress.address | Medplum](/content/docs/sdk/core-mailaddress-address.html): Home > @medplum/core > MailAddress > address (8 words) - [core.iserror | Medplum](/content/docs/sdk/core-iserror.html): Home > @medplum/core > isError (55 words) - [core.ismedicationorderresponse | Medplum](/content/docs/sdk/core-ismedicationorderresponse.html): Home > @medplum/core > isMedicationOrderResponse (44 words) - [core.loginauthenticationresponse.mfarequired | Medplum](/content/docs/sdk/core-loginauthenticationresponse-mfarequired.html): Home > @medplum/core > LoginAuthenticationResponse > mfaRequired (9 words) - [core.lrucache.clear | Medplum](/content/docs/sdk/core-lrucache-clear.html): Home > @medplum/core > LRUCache > clear (15 words) - [core.isatom._constructor_ | Medplum](/content/docs/sdk/core-isatom-_constructor_.html): Home > @medplum/core > IsAtom > (constructor) (22 words) - [core.logmessage.timestamp | Medplum](/content/docs/sdk/core-logmessage-timestamp.html): Home > @medplum/core > LogMessage > timestamp (13 words) - [core.ireconnectingwebsocket.send | Medplum](/content/docs/sdk/core-ireconnectingwebsocket-send.html): Home > @medplum/core > IReconnectingWebSocket > send (17 words) - [core.loginauthenticationresponse.memberships | Medplum](/content/docs/sdk/core-loginauthenticationresponse-memberships.html): Home > @medplum/core > LoginAuthenticationResponse > memberships (6 words) - [core.iwebsocket.readystate | Medplum](/content/docs/sdk/core-iwebsocket-readystate.html): Home > @medplum/core > IWebSocket > readyState (8 words) - [core.ismedicationcheckoutresponse | Medplum](/content/docs/sdk/core-ismedicationcheckoutresponse.html): Home > @medplum/core > isMedicationCheckoutResponse (38 words) - [core.ireconnectingwebsocket.reconnect | Medplum](/content/docs/sdk/core-ireconnectingwebsocket-reconnect.html): Home > @medplum/core > IReconnectingWebSocket > reconnect (23 words) - [core.isjwt | Medplum](/content/docs/sdk/core-isjwt.html): Home > @medplum/core > isJwt (36 words) - [core.isdefined | Medplum](/content/docs/sdk/core-isdefined.html): Home > @medplum/core > isDefined (57 words) - [core.isgone | Medplum](/content/docs/sdk/core-isgone.html): Home > @medplum/core > isGone (20 words) - [core.logger.prefix | Medplum](/content/docs/sdk/core-logger-prefix.html): Home > @medplum/core > Logger > prefix (14 words) - [core.isaddpharmacyresponse | Medplum](/content/docs/sdk/core-isaddpharmacyresponse.html): Home > @medplum/core > isAddPharmacyResponse (42 words) - [core.ireconnectingwebsocketctor._new_ | Medplum](/content/docs/sdk/core-ireconnectingwebsocketctor-_new_.html): Home > @medplum/core > IReconnectingWebSocketCtor > (new) (24 words) - [core.isdestructive | Medplum](/content/docs/sdk/core-isdestructive.html): Home > @medplum/core > isDestructive (25 words) - [core.isackcode | Medplum](/content/docs/sdk/core-isackcode.html): Home > @medplum/core > isAckCode (60 words) - [core.isdatestring | Medplum](/content/docs/sdk/core-isdatestring.html): Home > @medplum/core > isDateString (46 words) - [core.loinc | Medplum](/content/docs/sdk/core-loinc.html): Home > @medplum/core > LOINC (6 words) - [Modeling Questionnaires and Responses | Medplum](/content/docs/questionnaires/questionnaires-and-responses/index.html): Questionnaires are used to organize a collection of questions to gather healthcare information and are modeled in FHIR as a Questionnaire resource. The responses to these questions are modeled with the QuestionnaireResponse resource. (1,972 words) - [core.isfhircriteriamet | Medplum](/content/docs/sdk/core-isfhircriteriamet.html): Home > @medplum/core > isFhirCriteriaMet (34 words) - [core.islowercase | Medplum](/content/docs/sdk/core-islowercase.html): Home > @medplum/core > isLowerCase (20 words) - [core.invalidsearchoperator | Medplum](/content/docs/sdk/core-invalidsearchoperator.html): Home > @medplum/core > invalidSearchOperator (24 words) - [core.invalidoperationerror | Medplum](/content/docs/sdk/core-invalidoperationerror.html): Home > @medplum/core > InvalidOperationError (35 words) - [assets/files/formulary-examples-63cc0be541c2bed8fc660d9990ce7511-json.html](/content/assets/files/formulary-examples-63cc0be541c2bed8fc660d9990ce7511-json.html) (447 words) - [core.iscodeableconcept | Medplum](/content/docs/sdk/core-iscodeableconcept.html): Home > @medplum/core > isCodeableConcept (68 words) - [core.iscontextversionrequired | Medplum](/content/docs/sdk/core-iscontextversionrequired.html): Home > @medplum/core > isContextVersionRequired (24 words) - [core.iscreated | Medplum](/content/docs/sdk/core-iscreated.html): Home > @medplum/core > isCreated (26 words) - [core.isempty | Medplum](/content/docs/sdk/core-isempty.html): Home > @medplum/core > isEmpty (45 words) - [core.isdatetimestring | Medplum](/content/docs/sdk/core-isdatetimestring.html): Home > @medplum/core > isDateTimeString (43 words) - [core.iscomplextypecode | Medplum](/content/docs/sdk/core-iscomplextypecode.html): Home > @medplum/core > isComplexTypeCode (20 words) - [core.ireconnectingwebsocket.close | Medplum](/content/docs/sdk/core-ireconnectingwebsocket-close.html): Home > @medplum/core > IReconnectingWebSocket > close (23 words) - [core.hl7segment | Medplum](/content/docs/sdk/core-hl7segment.html): Home > @medplum/core > Hl7Segment (293 words) - [core.inviterequest.mfarequired | Medplum](/content/docs/sdk/core-inviterequest-mfarequired.html): Home > @medplum/core > InviteRequest > mfaRequired (6 words) - [core.iscompletedsubscriptionrequest | Medplum](/content/docs/sdk/core-iscompletedsubscriptionrequest.html): Home > @medplum/core > isCompletedSubscriptionRequest (24 words) - [core.indexeratom | Medplum](/content/docs/sdk/core-indexeratom.html): Home > @medplum/core > IndexerAtom (48 words) - [core.isdayofweek | Medplum](/content/docs/sdk/core-isdayofweek.html): Home > @medplum/core > isDayOfWeek (25 words) - [core.internalschemaelement | Medplum](/content/docs/sdk/core-internalschemaelement.html): Home > @medplum/core > InternalSchemaElement (42 words) - [core.ireconnectingwebsocketctor | Medplum](/content/docs/sdk/core-ireconnectingwebsocketctor.html): Home > @medplum/core > IReconnectingWebSocketCtor (15 words) - [core.inviterequest.upsert | Medplum](/content/docs/sdk/core-inviterequest-upsert.html): Home > @medplum/core > InviteRequest > upsert (7 words) - [core.infixoperatoratom | Medplum](/content/docs/sdk/core-infixoperatoratom.html): Home > @medplum/core > InfixOperatorAtom (54 words) - [core.intersection | Medplum](/content/docs/sdk/core-intersection.html): Home > @medplum/core > intersection (61 words) - [core.internalschemaelement.slicing | Medplum](/content/docs/sdk/core-internalschemaelement-slicing.html): Home > @medplum/core > InternalSchemaElement > slicing (8 words) - [core.internaltypeschema.type | Medplum](/content/docs/sdk/core-internaltypeschema-type.html): Home > @medplum/core > InternalTypeSchema > type (8 words) - [core.inviterequest.lastname | Medplum](/content/docs/sdk/core-inviterequest-lastname.html): Home > @medplum/core > InviteRequest > lastName (8 words) - [core.invalid_medication_checkout_response | Medplum](/content/docs/sdk/core-invalid_medication_checkout_response.html): Home > @medplum/core > INVALID\MEDICATION\CHECKOUT\RESPONSE (21 words) - [core.inviterequest.sendemail | Medplum](/content/docs/sdk/core-inviterequest-sendemail.html): Home > @medplum/core > InviteRequest > sendEmail (8 words) - [core.inviterequest.scope | Medplum](/content/docs/sdk/core-inviterequest-scope.html): Home > @medplum/core > InviteRequest > scope (9 words) - [core.invalid_medication_order_set_response | Medplum](/content/docs/sdk/core-invalid_medication_order_set_response.html): Home > @medplum/core > INVALID\MEDICATION\ORDER\SET\RESPONSE (28 words) - [core.isaccepted | Medplum](/content/docs/sdk/core-isaccepted.html): Home > @medplum/core > isAccepted (17 words) - [core.includetarget | Medplum](/content/docs/sdk/core-includetarget.html): Home > @medplum/core > IncludeTarget (24 words) - [core.invalidoperationerror._constructor_ | Medplum](/content/docs/sdk/core-invalidoperationerror-_constructor_.html): Home > @medplum/core > InvalidOperationError > (constructor) (20 words) - [core.inviterequest.externalid | Medplum](/content/docs/sdk/core-inviterequest-externalid.html): Home > @medplum/core > InviteRequest > externalId (7 words) - [core.internaltypeschema.constraints | Medplum](/content/docs/sdk/core-internaltypeschema-constraints.html): Home > @medplum/core > InternalTypeSchema > constraints (8 words) - [core.inviterequest.accesspolicy | Medplum](/content/docs/sdk/core-inviterequest-accesspolicy.html): Home > @medplum/core > InviteRequest > accessPolicy (17 words) - [core.infixoperatoratom.eval | Medplum](/content/docs/sdk/core-infixoperatoratom-eval.html): Home > @medplum/core > InfixOperatorAtom > eval (28 words) - [core.invalid_medication_cart_response | Medplum](/content/docs/sdk/core-invalid_medication_cart_response.html): Home > @medplum/core > INVALID\MEDICATION\CART\RESPONSE (24 words) - [core.inviterequest.admin | Medplum](/content/docs/sdk/core-inviterequest-admin.html): Home > @medplum/core > InviteRequest > admin (22 words) - [core.inviterequest.firstname | Medplum](/content/docs/sdk/core-inviterequest-firstname.html): Home > @medplum/core > InviteRequest > firstName (7 words) - [core.ilogger | Medplum](/content/docs/sdk/core-ilogger.html): Home > @medplum/core > ILogger (32 words) - [core.internaltypeschema.title | Medplum](/content/docs/sdk/core-internaltypeschema-title.html): Home > @medplum/core > InternalTypeSchema > title (7 words) - [core.internaltypeschema.url | Medplum](/content/docs/sdk/core-internaltypeschema-url.html): Home > @medplum/core > InternalTypeSchema > url (13 words) - [core.iclientstorage.setstring | Medplum](/content/docs/sdk/core-iclientstorage-setstring.html): Home > @medplum/core > IClientStorage > setString (25 words) - [core.inviterequest.password | Medplum](/content/docs/sdk/core-inviterequest-password.html): Home > @medplum/core > InviteRequest > password (7 words) - [core.internaltypeschema.name | Medplum](/content/docs/sdk/core-internaltypeschema-name.html): Home > @medplum/core > InternalTypeSchema > name (8 words) - [core.internaltypeschema.path | Medplum](/content/docs/sdk/core-internaltypeschema-path.html): Home > @medplum/core > InternalTypeSchema > path (13 words) - [core.internaltypeschema.mandatoryproperties | Medplum](/content/docs/sdk/core-internaltypeschema-mandatoryproperties.html): Home > @medplum/core > InternalTypeSchema > mandatoryProperties (7 words) - [core.invalid_medication_order_response | Medplum](/content/docs/sdk/core-invalid_medication_order_response.html): Home > @medplum/core > INVALID\MEDICATION\ORDER\RESPONSE (21 words) - [core.impliesatom | Medplum](/content/docs/sdk/core-impliesatom.html): Home > @medplum/core > ImpliesAtom (77 words) - [core.internaltypeschema.summaryproperties | Medplum](/content/docs/sdk/core-internaltypeschema-summaryproperties.html): Home > @medplum/core > InternalTypeSchema > summaryProperties (7 words) - [core.internaltypeschema.elements | Medplum](/content/docs/sdk/core-internaltypeschema-elements.html): Home > @medplum/core > InternalTypeSchema > elements (14 words) - [core.infixparselet.parse | Medplum](/content/docs/sdk/core-infixparselet-parse.html): Home > @medplum/core > InfixParselet > parse (27 words) - [core.indexedstructuredefinition | Medplum](/content/docs/sdk/core-indexedstructuredefinition.html): Home > @medplum/core > IndexedStructureDefinition (166 words) - [core.indexeratom.eval | Medplum](/content/docs/sdk/core-indexeratom-eval.html): Home > @medplum/core > IndexerAtom > eval (27 words) - [core.internaltypeschema.parenttype | Medplum](/content/docs/sdk/core-internaltypeschema-parenttype.html): Home > @medplum/core > InternalTypeSchema > parentType (7 words) - [core.internalschemaelement.min | Medplum](/content/docs/sdk/core-internalschemaelement-min.html): Home > @medplum/core > InternalSchemaElement > min (7 words) - [core.internalschemaelement.isarray | Medplum](/content/docs/sdk/core-internalschemaelement-isarray.html): Home > @medplum/core > InternalSchemaElement > isArray (8 words) - [core.internaltypeschema.innertypes | Medplum](/content/docs/sdk/core-internaltypeschema-innertypes.html): Home > @medplum/core > InternalTypeSchema > innerTypes (7 words) - [core.internalschemaelement.description | Medplum](/content/docs/sdk/core-internalschemaelement-description.html): Home > @medplum/core > InternalSchemaElement > description (13 words) - [core.inflatebaseschema | Medplum](/content/docs/sdk/core-inflatebaseschema.html): Home > @medplum/core > inflateBaseSchema (20 words) - [core.internalschemaelement.max | Medplum](/content/docs/sdk/core-internalschemaelement-max.html): Home > @medplum/core > InternalSchemaElement > max (7 words) - [core.internalschemaelement.pattern | Medplum](/content/docs/sdk/core-internalschemaelement-pattern.html): Home > @medplum/core > InternalSchemaElement > pattern (7 words) - [core.infixparselet | Medplum](/content/docs/sdk/core-infixparselet.html): Home > @medplum/core > InfixParselet (24 words) - [decision-guides/messaging-pdf.html](/content/decision-guides/messaging-pdf.html) (1,668 words) - [core.indexsearchparameter | Medplum](/content/docs/sdk/core-indexsearchparameter.html): Home > @medplum/core > indexSearchParameter (46 words) - [core.internalschemaelement.path | Medplum](/content/docs/sdk/core-internalschemaelement-path.html): Home > @medplum/core > InternalSchemaElement > path (7 words) - [core.indexdefaultsearchparameters | Medplum](/content/docs/sdk/core-indexdefaultsearchparameters.html): Home > @medplum/core > indexDefaultSearchParameters (23 words) - [core.inflateelement | Medplum](/content/docs/sdk/core-inflateelement.html): Home > @medplum/core > inflateElement (23 words) - [core.indexeratom._constructor_ | Medplum](/content/docs/sdk/core-indexeratom-_constructor_.html): Home > @medplum/core > IndexerAtom > (constructor) (22 words) - [core.internalschemaelement.fixed | Medplum](/content/docs/sdk/core-internalschemaelement-fixed.html): Home > @medplum/core > InternalSchemaElement > fixed (7 words) - [core.internalschemaelement.constraints | Medplum](/content/docs/sdk/core-internalschemaelement-constraints.html): Home > @medplum/core > InternalSchemaElement > constraints (8 words) - [core.infixoperatoratom._constructor_ | Medplum](/content/docs/sdk/core-infixoperatoratom-_constructor_.html): Home > @medplum/core > InfixOperatorAtom > (constructor) (28 words) - [core.internalschemaelement.binding | Medplum](/content/docs/sdk/core-internalschemaelement-binding.html): Home > @medplum/core > InternalSchemaElement > binding (7 words) - [core.indexeratom.left | Medplum](/content/docs/sdk/core-indexeratom-left.html): Home > @medplum/core > IndexerAtom > left (14 words) - [core.inatom | Medplum](/content/docs/sdk/core-inatom.html): Home > @medplum/core > InAtom (35 words) - [core.indexstructuredefinitionbundle | Medplum](/content/docs/sdk/core-indexstructuredefinitionbundle.html): Home > @medplum/core > indexStructureDefinitionBundle (38 words) - [core.infixoperatoratom.operator | Medplum](/content/docs/sdk/core-infixoperatoratom-operator.html): Home > @medplum/core > InfixOperatorAtom > operator (9 words) - [core.indexsearchparameterbundle | Medplum](/content/docs/sdk/core-indexsearchparameterbundle.html): Home > @medplum/core > indexSearchParameterBundle (33 words) - [core.initfhirpathparserbuilder | Medplum](/content/docs/sdk/core-initfhirpathparserbuilder.html): Home > @medplum/core > initFhirPathParserBuilder (10 words) - [core.infixparselet.precedence | Medplum](/content/docs/sdk/core-infixparselet-precedence.html): Home > @medplum/core > InfixParselet > precedence (8 words) - [core.infixoperatoratom.tostring | Medplum](/content/docs/sdk/core-infixoperatoratom-tostring.html): Home > @medplum/core > InfixOperatorAtom > toString (10 words) - [core.infixoperatoratom.right | Medplum](/content/docs/sdk/core-infixoperatoratom-right.html): Home > @medplum/core > InfixOperatorAtom > right (9 words) - [core.impliesatom.eval | Medplum](/content/docs/sdk/core-impliesatom-eval.html): Home > @medplum/core > ImpliesAtom > eval (21 words) - [core.includetarget.searchparam | Medplum](/content/docs/sdk/core-includetarget-searchparam.html): Home > @medplum/core > IncludeTarget > searchParam (7 words) - [core.inatom._constructor_ | Medplum](/content/docs/sdk/core-inatom-_constructor_.html): Home > @medplum/core > InAtom > (constructor) (24 words) - [core.indexeratom.tostring | Medplum](/content/docs/sdk/core-indexeratom-tostring.html): Home > @medplum/core > IndexerAtom > toString (10 words) - [core.impliesatom._constructor_ | Medplum](/content/docs/sdk/core-impliesatom-_constructor_.html): Home > @medplum/core > ImpliesAtom > (constructor) (22 words) - [core.hl7segment.setcomponent | Medplum](/content/docs/sdk/core-hl7segment-setcomponent.html): Home > @medplum/core > Hl7Segment > setComponent (87 words) - [core.hl7message.getall | Medplum](/content/docs/sdk/core-hl7message-getall.html): Home > @medplum/core > Hl7Message > getAll (59 words) - [core.includetarget.resourcetype | Medplum](/content/docs/sdk/core-includetarget-resourcetype.html): Home > @medplum/core > IncludeTarget > resourceType (13 words) - [core.inatom.eval | Medplum](/content/docs/sdk/core-inatom-eval.html): Home > @medplum/core > InAtom > eval (18 words) - [core.indexedstructuredefinition.types | Medplum](/content/docs/sdk/core-indexedstructuredefinition-types.html): Home > @medplum/core > IndexedStructureDefinition > types (8 words) - [core.iloggerconfig | Medplum](/content/docs/sdk/core-iloggerconfig.html): Home > @medplum/core > ILoggerConfig (22 words) - [core.hl7segment.getcomponent | Medplum](/content/docs/sdk/core-hl7segment-getcomponent.html): Home > @medplum/core > Hl7Segment > getComponent (94 words) - [core.iloggerconfig.level | Medplum](/content/docs/sdk/core-iloggerconfig-level.html): Home > @medplum/core > ILoggerConfig > level (13 words) - [core.iclientstorage | Medplum](/content/docs/sdk/core-iclientstorage.html): Home > @medplum/core > IClientStorage (22 words) - [core.indexeratom.expr | Medplum](/content/docs/sdk/core-indexeratom-expr.html): Home > @medplum/core > IndexerAtom > expr (8 words) - [core.iclientstorage.makekey | Medplum](/content/docs/sdk/core-iclientstorage-makekey.html): Home > @medplum/core > IClientStorage > makeKey (23 words) - [core.hl7segment.parse | Medplum](/content/docs/sdk/core-hl7segment-parse.html): Home > @medplum/core > Hl7Segment > parse (41 words) - [core.getdisplaystring | Medplum](/content/docs/sdk/core-getdisplaystring.html): Home > @medplum/core > getDisplayString (31 words) - [core.includetarget.modifier | Medplum](/content/docs/sdk/core-includetarget-modifier.html): Home > @medplum/core > IncludeTarget > modifier (7 words) - [core.includetarget.targettype | Medplum](/content/docs/sdk/core-includetarget-targettype.html): Home > @medplum/core > IncludeTarget > targetType (7 words) - [core.hl7message.getacktype | Medplum](/content/docs/sdk/core-hl7message-getacktype.html): Home > @medplum/core > Hl7Message > getAckType (80 words) - [core.hl7field.setcomponent | Medplum](/content/docs/sdk/core-hl7field-setcomponent.html): Home > @medplum/core > Hl7Field > setComponent (70 words) - [core.hl7message.getsegment | Medplum](/content/docs/sdk/core-hl7message-getsegment.html): Home > @medplum/core > Hl7Message > getSegment (98 words) - [core.hl7segment._constructor_ | Medplum](/content/docs/sdk/core-hl7segment-_constructor_.html): Home > @medplum/core > Hl7Segment > (constructor) (55 words) - [core.iloggerconfig.options | Medplum](/content/docs/sdk/core-iloggerconfig-options.html): Home > @medplum/core > ILoggerConfig > options (13 words) - [core.iloggerconfig.metadata | Medplum](/content/docs/sdk/core-iloggerconfig-metadata.html): Home > @medplum/core > ILoggerConfig > metadata (9 words) - [core.hl7segment.getfield | Medplum](/content/docs/sdk/core-hl7segment-getfield.html): Home > @medplum/core > Hl7Segment > getField (70 words) - [core.hl7message.buildack | Medplum](/content/docs/sdk/core-hl7message-buildack.html): Home > @medplum/core > Hl7Message > buildAck (39 words) - [core.ilogger.level | Medplum](/content/docs/sdk/core-ilogger-level.html): Home > @medplum/core > ILogger > level (8 words) - [core.hl7message.segments | Medplum](/content/docs/sdk/core-hl7message-segments.html): Home > @medplum/core > Hl7Message > segments (39 words) - [core.iclientstorage.setobject | Medplum](/content/docs/sdk/core-iclientstorage-setobject.html): Home > @medplum/core > IClientStorage > setObject (23 words) - [core.hl7segment.setfield | Medplum](/content/docs/sdk/core-hl7segment-setfield.html): Home > @medplum/core > Hl7Segment > setField (65 words) - [core.functionatom.name | Medplum](/content/docs/sdk/core-functionatom-name.html): Home > @medplum/core > FunctionAtom > name (9 words) - [core.iclientstorage.getobject | Medplum](/content/docs/sdk/core-iclientstorage-getobject.html): Home > @medplum/core > IClientStorage > getObject (21 words) - [core.ilogger.info | Medplum](/content/docs/sdk/core-ilogger-info.html): Home > @medplum/core > ILogger > info (25 words) - [core.ilogger.clone | Medplum](/content/docs/sdk/core-ilogger-clone.html): Home > @medplum/core > ILogger > clone (15 words) - [core.iclientstorage.clear | Medplum](/content/docs/sdk/core-iclientstorage-clear.html): Home > @medplum/core > IClientStorage > clear (10 words) - [core.functionatom.tostring | Medplum](/content/docs/sdk/core-functionatom-tostring.html): Home > @medplum/core > FunctionAtom > toString (10 words) - [core.getpendingmedicationorderid | Medplum](/content/docs/sdk/core-getpendingmedicationorderid.html): Home > @medplum/core > getPendingMedicationOrderId (59 words) - [core.iclientstorage.getinitpromise | Medplum](/content/docs/sdk/core-iclientstorage-getinitpromise.html): Home > @medplum/core > IClientStorage > getInitPromise (10 words) - [core.humannameformatoptions.prefix | Medplum](/content/docs/sdk/core-humannameformatoptions-prefix.html): Home > @medplum/core > HumanNameFormatOptions > prefix (13 words) - [Building Migration Pipelines | Medplum](/content/docs/migration/migration-pipelines/index.html): When migrating data to Medplum, it's crucial to build efficient and reliable data pipelines. This section covers key strategies and best practices for constructing pipelines to migration data into Medplum. (1,614 words) - [core.hl7segment.fields | Medplum](/content/docs/sdk/core-hl7segment-fields.html): Home > @medplum/core > Hl7Segment > fields (42 words) - [core.hl7dateparseoptions.tzoffset | Medplum](/content/docs/sdk/core-hl7dateparseoptions-tzoffset.html): Home > @medplum/core > Hl7DateParseOptions > tzOffset (12 words) - [core.hl7segment.name | Medplum](/content/docs/sdk/core-hl7segment-name.html): Home > @medplum/core > Hl7Segment > name (14 words) - [core.hl7message._constructor_ | Medplum](/content/docs/sdk/core-hl7message-_constructor_.html): Home > @medplum/core > Hl7Message > (constructor) (45 words) - [core.http_hl7_org | Medplum](/content/docs/sdk/core-http_hl7_org.html): Home > @medplum/core > HTTP\HL7\ORG (8 words) - [core.hl7field.get | Medplum](/content/docs/sdk/core-hl7field-get.html): Home > @medplum/core > Hl7Field > get (64 words) - [core.icd10 | Medplum](/content/docs/sdk/core-icd10.html): Home > @medplum/core > ICD10 (14 words) - [core.hl7context._constructor_ | Medplum](/content/docs/sdk/core-hl7context-_constructor_.html): Home > @medplum/core > Hl7Context > (constructor) (44 words) - [core.humannameformatoptions.all | Medplum](/content/docs/sdk/core-humannameformatoptions-all.html): Home > @medplum/core > HumanNameFormatOptions > all (8 words) - [core.humannameformatoptions.use | Medplum](/content/docs/sdk/core-humannameformatoptions-use.html): Home > @medplum/core > HumanNameFormatOptions > use (7 words) - [core.hl7ackoptions | Medplum](/content/docs/sdk/core-hl7ackoptions.html): Home > @medplum/core > Hl7AckOptions (19 words) - [core.hl7message.get | Medplum](/content/docs/sdk/core-hl7message-get.html): Home > @medplum/core > Hl7Message > get (62 words) - [core.hl7message.tostring | Medplum](/content/docs/sdk/core-hl7message-tostring.html): Home > @medplum/core > Hl7Message > toString (42 words) - [core.googleloginrequest | Medplum](/content/docs/sdk/core-googleloginrequest.html): Home > @medplum/core > GoogleLoginRequest (36 words) - [core.formathumanname | Medplum](/content/docs/sdk/core-formathumanname.html): Home > @medplum/core > formatHumanName (48 words) - [core.fhircast_event_resources | Medplum](/content/docs/sdk/core-fhircast_event_resources.html): Home > @medplum/core > FHIRCAST\EVENT\RESOURCES (315 words) - [core.http_terminology_hl7_org | Medplum](/content/docs/sdk/core-http_terminology_hl7_org.html): Home > @medplum/core > HTTP\TERMINOLOGY\HL7\ORG (6 words) - [core.hl7context.getmsh2 | Medplum](/content/docs/sdk/core-hl7context-getmsh2.html): Home > @medplum/core > Hl7Context > getMsh2 (24 words) - [core.getscheduleparameters | Medplum](/content/docs/sdk/core-getscheduleparameters.html): Home > @medplum/core > getScheduleParameters (113 words) - [core.hl7field.getcomponent | Medplum](/content/docs/sdk/core-hl7field-getcomponent.html): Home > @medplum/core > Hl7Field > getComponent (72 words) - [core.hl7field.parse | Medplum](/content/docs/sdk/core-hl7field-parse.html): Home > @medplum/core > Hl7Field > parse (44 words) - [core.googleloginrequest.googleclientid | Medplum](/content/docs/sdk/core-googleloginrequest-googleclientid.html): Home > @medplum/core > GoogleLoginRequest > googleClientId (9 words) - [core.hl7field.tostring | Medplum](/content/docs/sdk/core-hl7field-tostring.html): Home > @medplum/core > Hl7Field > toString (21 words) - [core.getpreferredpharmaciesfrompatient | Medplum](/content/docs/sdk/core-getpreferredpharmaciesfrompatient.html): Home > @medplum/core > getPreferredPharmaciesFromPatient (84 words) - [core.hl7dateparseoptions | Medplum](/content/docs/sdk/core-hl7dateparseoptions.html): Home > @medplum/core > Hl7DateParseOptions (19 words) - [core.gettypedpropertyvalue | Medplum](/content/docs/sdk/core-gettypedpropertyvalue.html): Home > @medplum/core > getTypedPropertyValue (105 words) - [core.getquerystring | Medplum](/content/docs/sdk/core-getquerystring.html): Home > @medplum/core > getQueryString (46 words) - [core.getnestedproperty_1 | Medplum](/content/docs/sdk/core-getnestedproperty_1.html): Home > @medplum/core > getNestedProperty (52 words) - [core.hl7context.repetitionseparator | Medplum](/content/docs/sdk/core-hl7context-repetitionseparator.html): Home > @medplum/core > Hl7Context > repetitionSeparator (9 words) - [core.getsearchparameter | Medplum](/content/docs/sdk/core-getsearchparameter.html): Home > @medplum/core > getSearchParameter (50 words) - [core.hl7context.fieldseparator | Medplum](/content/docs/sdk/core-hl7context-fieldseparator.html): Home > @medplum/core > Hl7Context > fieldSeparator (9 words) - [core.hl7field._constructor_ | Medplum](/content/docs/sdk/core-hl7field-_constructor_.html): Home > @medplum/core > Hl7Field > (constructor) (27 words) - [core.hl7context.componentseparator | Medplum](/content/docs/sdk/core-hl7context-componentseparator.html): Home > @medplum/core > Hl7Context > componentSeparator (9 words) - [core.getvalueslicename | Medplum](/content/docs/sdk/core-getvalueslicename.html): Home > @medplum/core > getValueSliceName (40 words) - [core.hl7field.components | Medplum](/content/docs/sdk/core-hl7field-components.html): Home > @medplum/core > Hl7Field > components (8 words) - [core.hl7ackoptions.errsegment | Medplum](/content/docs/sdk/core-hl7ackoptions-errsegment.html): Home > @medplum/core > Hl7AckOptions > errSegment (8 words) - [core.hl7context.subcomponentseparator | Medplum](/content/docs/sdk/core-hl7context-subcomponentseparator.html): Home > @medplum/core > Hl7Context > subcomponentSeparator (9 words) - [core.hl7context.getmsh1 | Medplum](/content/docs/sdk/core-hl7context-getmsh1.html): Home > @medplum/core > Hl7Context > getMsh1 (24 words) - [core.gettypedpropertyvaluewithschema | Medplum](/content/docs/sdk/core-gettypedpropertyvaluewithschema.html): Home > @medplum/core > getTypedPropertyValueWithSchema (71 words) - [core.gettypedpropertyvaluewithoutschema | Medplum](/content/docs/sdk/core-gettypedpropertyvaluewithoutschema.html): Home > @medplum/core > getTypedPropertyValueWithoutSchema (85 words) - [core.getresourcetypes | Medplum](/content/docs/sdk/core-getresourcetypes.html): Home > @medplum/core > getResourceTypes (44 words) - [core.getsearchparameterdetails | Medplum](/content/docs/sdk/core-getsearchparameterdetails.html): Home > @medplum/core > getSearchParameterDetails (79 words) - [core.getwebsocketurl | Medplum](/content/docs/sdk/core-getwebsocketurl.html): Home > @medplum/core > getWebSocketUrl (63 words) - [core.hl7context.escapecharacter | Medplum](/content/docs/sdk/core-hl7context-escapecharacter.html): Home > @medplum/core > Hl7Context > escapeCharacter (8 words) - [core.getpropertydisplayname | Medplum](/content/docs/sdk/core-getpropertydisplayname.html): Home > @medplum/core > getPropertyDisplayName (48 words) - [core.gettypedpropertyvalueoptions.profileurl | Medplum](/content/docs/sdk/core-gettypedpropertyvalueoptions-profileurl.html): Home > @medplum/core > GetTypedPropertyValueOptions > profileUrl (17 words) - [core.getsearchparameters | Medplum](/content/docs/sdk/core-getsearchparameters.html): Home > @medplum/core > getSearchParameters (52 words) - [core.googlecredentialresponse.clientid | Medplum](/content/docs/sdk/core-googlecredentialresponse-clientid.html): Home > @medplum/core > GoogleCredentialResponse > clientId (9 words) - [core.googlecredentialresponse.credential | Medplum](/content/docs/sdk/core-googlecredentialresponse-credential.html): Home > @medplum/core > GoogleCredentialResponse > credential (9 words) - [core.googlecredentialresponse | Medplum](/content/docs/sdk/core-googlecredentialresponse.html): Home > @medplum/core > GoogleCredentialResponse (17 words) - [core.getsearchresourcetypes | Medplum](/content/docs/sdk/core-getsearchresourcetypes.html): Home > @medplum/core > getSearchResourceTypes (20 words) - [core.getwindow | Medplum](/content/docs/sdk/core-getwindow.html): Home > @medplum/core > getWindow (28 words) - [core.getsmarthealthlinkid | Medplum](/content/docs/sdk/core-getsmarthealthlinkid.html): Home > @medplum/core > getSmartHealthLinkId (24 words) - [core.googleloginrequest.googlecredential | Medplum](/content/docs/sdk/core-googleloginrequest-googlecredential.html): Home > @medplum/core > GoogleLoginRequest > googleCredential (8 words) - [core.googleloginrequest.createuser | Medplum](/content/docs/sdk/core-googleloginrequest-createuser.html): Home > @medplum/core > GoogleLoginRequest > createUser (8 words) - [core.getstatus | Medplum](/content/docs/sdk/core-getstatus.html): Home > @medplum/core > getStatus (20 words) - [core.getelementdefinition | Medplum](/content/docs/sdk/core-getelementdefinition.html): Home > @medplum/core > getElementDefinition (61 words) - [core.getpathdifference | Medplum](/content/docs/sdk/core-getpathdifference.html): Home > @medplum/core > getPathDifference (82 words) - [core.getoutcomeredirecturl | Medplum](/content/docs/sdk/core-getoutcomeredirecturl.html): Home > @medplum/core > getOutcomeRedirectUrl (28 words) - [core.gettypedpropertyvalueoptions | Medplum](/content/docs/sdk/core-gettypedpropertyvalueoptions.html): Home > @medplum/core > GetTypedPropertyValueOptions (23 words) - [core.getparsedexpressionforresourcetype | Medplum](/content/docs/sdk/core-getparsedexpressionforresourcetype.html): Home > @medplum/core > getParsedExpressionForResourceType (24 words) - [core.getreferencestring_1 | Medplum](/content/docs/sdk/core-getreferencestring_1.html): Home > @medplum/core > getReferenceString (28 words) - [core.fhirpathatom.eval | Medplum](/content/docs/sdk/core-fhirpathatom-eval.html): Home > @medplum/core > FhirPathAtom > eval (18 words) - [core.gone | Medplum](/content/docs/sdk/core-gone.html): Home > @medplum/core > gone (7 words) - [core.getdatatype | Medplum](/content/docs/sdk/core-getdatatype.html): Home > @medplum/core > getDataType (31 words) - [core.functionatom | Medplum](/content/docs/sdk/core-functionatom.html): Home > @medplum/core > FunctionAtom (48 words) - [core.getquestionnaireanswers | Medplum](/content/docs/sdk/core-getquestionnaireanswers.html): Home > @medplum/core > getQuestionnaireAnswers (36 words) - [core.getpathdisplayname | Medplum](/content/docs/sdk/core-getpathdisplayname.html): Home > @medplum/core > getPathDisplayName (43 words) - [core.getbuffer | Medplum](/content/docs/sdk/core-getbuffer.html): Home > @medplum/core > getBuffer (29 words) - [core.getnestedproperty | Medplum](/content/docs/sdk/core-getnestedproperty.html): Home > @medplum/core > getNestedProperty (47 words) - [core.getextensions | Medplum](/content/docs/sdk/core-getextensions.html): Home > @medplum/core > getExtensions (135 words) - [core.functionatom.eval | Medplum](/content/docs/sdk/core-functionatom-eval.html): Home > @medplum/core > FunctionAtom > eval (27 words) - [core.formatwalltime | Medplum](/content/docs/sdk/core-formatwalltime.html): Home > @medplum/core > formatWallTime (70 words) - [core.getrandomstring | Medplum](/content/docs/sdk/core-getrandomstring.html): Home > @medplum/core > getRandomString (23 words) - [core.getdefaultvaluesfornewsliceentry | Medplum](/content/docs/sdk/core-getdefaultvaluesfornewsliceentry.html): Home > @medplum/core > getDefaultValuesForNewSliceEntry (32 words) - [core.getallquestionnaireanswers | Medplum](/content/docs/sdk/core-getallquestionnaireanswers.html): Home > @medplum/core > getAllQuestionnaireAnswers (42 words) - [core.getcodebysystem | Medplum](/content/docs/sdk/core-getcodebysystem.html): Home > @medplum/core > getCodeBySystem (52 words) - [core.fhircasteventcontext | Medplum](/content/docs/sdk/core-fhircasteventcontext.html): Home > @medplum/core > FhircastEventContext (95 words) - [core.getextensionvalue | Medplum](/content/docs/sdk/core-getextensionvalue.html): Home > @medplum/core > getExtensionValue (61 words) - [core.formatgivenname | Medplum](/content/docs/sdk/core-formatgivenname.html): Home > @medplum/core > formatGivenName (39 words) - [core.getmedicationorderiframeurl | Medplum](/content/docs/sdk/core-getmedicationorderiframeurl.html): Home > @medplum/core > getMedicationOrderIframeUrl (46 words) - [core.generatesmarthealthlinkparams.passcode | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-passcode.html): Home > @medplum/core > GenerateSmartHealthLinkParams > passcode (7 words) - [core.getexpressionforresourcetype | Medplum](/content/docs/sdk/core-getexpressionforresourcetype.html): Home > @medplum/core > getExpressionForResourceType (27 words) - [core.findobservationreferencerange | Medplum](/content/docs/sdk/core-findobservationreferencerange.html): Home > @medplum/core > findObservationReferenceRange (59 words) - [core.getimagesrc | Medplum](/content/docs/sdk/core-getimagesrc.html): Home > @medplum/core > getImageSrc (46 words) - [core.getelementdefinitionfromelements | Medplum](/content/docs/sdk/core-getelementdefinitionfromelements.html): Home > @medplum/core > getElementDefinitionFromElements (57 words) - [core.getelementdefinitiontypename | Medplum](/content/docs/sdk/core-getelementdefinitiontypename.html): Home > @medplum/core > getElementDefinitionTypeName (40 words) - [core.generatesmarthealthlinkparams | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams.html): Home > @medplum/core > GenerateSmartHealthLinkParams (32 words) - [core.formatrange | Medplum](/content/docs/sdk/core-formatrange.html): Home > @medplum/core > formatRange (94 words) - [core.fhirpathatom | Medplum](/content/docs/sdk/core-fhirpathatom.html): Home > @medplum/core > FhirPathAtom (64 words) - [core.getidentifier | Medplum](/content/docs/sdk/core-getidentifier.html): Home > @medplum/core > getIdentifier (69 words) - [core.fhircasteventversionrequired | Medplum](/content/docs/sdk/core-fhircasteventversionrequired.html): Home > @medplum/core > FhircastEventVersionRequired (273 words) - [core.getdateproperty | Medplum](/content/docs/sdk/core-getdateproperty.html): Home > @medplum/core > getDateProperty (73 words) - [core.findresourcebycode | Medplum](/content/docs/sdk/core-findresourcebycode.html): Home > @medplum/core > findResourceByCode (89 words) - [core.getextension | Medplum](/content/docs/sdk/core-getextension.html): Home > @medplum/core > getExtension (51 words) - [core.formatsearchquery | Medplum](/content/docs/sdk/core-formatsearchquery.html): Home > @medplum/core > formatSearchQuery (41 words) - [core.generatesmarthealthlinkparams.exp | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-exp.html): Home > @medplum/core > GenerateSmartHealthLinkParams > exp (7 words) - [core.fhirpathequivalent | Medplum](/content/docs/sdk/core-fhirpathequivalent.html): Home > @medplum/core > fhirPathEquivalent (41 words) - [core.formatquantity | Medplum](/content/docs/sdk/core-formatquantity.html): Home > @medplum/core > formatQuantity (64 words) - [core.generatesmarthealthlinkparams.label | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-label.html): Home > @medplum/core > GenerateSmartHealthLinkParams > label (8 words) - [core.formatdatetime | Medplum](/content/docs/sdk/core-formatdatetime.html): Home > @medplum/core > formatDateTime (64 words) - [core.formattime | Medplum](/content/docs/sdk/core-formattime.html): Home > @medplum/core > formatTime (64 words) - [core.flatmapfilter | Medplum](/content/docs/sdk/core-flatmapfilter.html): Home > @medplum/core > flatMapFilter (44 words) - [core.getalldatatypes | Medplum](/content/docs/sdk/core-getalldatatypes.html): Home > @medplum/core > getAllDataTypes (12 words) - [decision-guides/intake-docx.html](/content/decision-guides/intake-docx.html) (2,586 words) - [core.formatreferencestring | Medplum](/content/docs/sdk/core-formatreferencestring.html): Home > @medplum/core > formatReferenceString (36 words) - [core.formatobservationvalue | Medplum](/content/docs/sdk/core-formatobservationvalue.html): Home > @medplum/core > formatObservationValue (48 words) - [core.findobservationinterval | Medplum](/content/docs/sdk/core-findobservationinterval.html): Home > @medplum/core > findObservationInterval (67 words) - [core.filebuilder | Medplum](/content/docs/sdk/core-filebuilder.html): Home > @medplum/core > FileBuilder (36 words) - [core.functionatom._constructor_ | Medplum](/content/docs/sdk/core-functionatom-_constructor_.html): Home > @medplum/core > FunctionAtom > (constructor) (22 words) - [core.formatfamilyname | Medplum](/content/docs/sdk/core-formatfamilyname.html): Home > @medplum/core > formatFamilyName (36 words) - [core.generatesmarthealthlinkparams.mode | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-mode.html): Home > @medplum/core > GenerateSmartHealthLinkParams > mode (7 words) - [core.formatdate | Medplum](/content/docs/sdk/core-formatdate.html): Home > @medplum/core > formatDate (70 words) - [core.generatesmarthealthlinkparams.includeqrcode | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-includeqrcode.html): Home > @medplum/core > GenerateSmartHealthLinkParams > includeQrCode (7 words) - [core.functionatom.args | Medplum](/content/docs/sdk/core-functionatom-args.html): Home > @medplum/core > FunctionAtom > args (14 words) - [core.fhirtypetojstype | Medplum](/content/docs/sdk/core-fhirtypetojstype.html): Home > @medplum/core > fhirTypeToJsType (75 words) - [core.fhirpathequals | Medplum](/content/docs/sdk/core-fhirpathequals.html): Home > @medplum/core > fhirPathEquals (40 words) - [core.generatesmarthealthlinkparams._type | Medplum](/content/docs/sdk/core-generatesmarthealthlinkparams-_type.html): Home > @medplum/core > GenerateSmartHealthLinkParams > \type (7 words) - [core.fhirpathpatch | Medplum](/content/docs/sdk/core-fhirpathpatch.html): Home > @medplum/core > FhirPathPatch (65 words) - [core.formatperiod | Medplum](/content/docs/sdk/core-formatperiod.html): Home > @medplum/core > formatPeriod (54 words) - [core.formattiming | Medplum](/content/docs/sdk/core-formattiming.html): Home > @medplum/core > formatTiming (38 words) - [core.generateid | Medplum](/content/docs/sdk/core-generateid.html): Home > @medplum/core > generateId (20 words) - [core.fhirfilterconnective | Medplum](/content/docs/sdk/core-fhirfilterconnective.html): Home > @medplum/core > FhirFilterConnective (56 words) - [core.formataddress | Medplum](/content/docs/sdk/core-formataddress.html): Home > @medplum/core > formatAddress (48 words) - [core.formatcoding | Medplum](/content/docs/sdk/core-formatcoding.html): Home > @medplum/core > formatCoding (52 words) - [core.filter | Medplum](/content/docs/sdk/core-filter.html): Home > @medplum/core > Filter (20 words) - [core.formatcodeableconcept | Medplum](/content/docs/sdk/core-formatcodeableconcept.html): Home > @medplum/core > formatCodeableConcept (36 words) - [core.fhirpatharraynotequals | Medplum](/content/docs/sdk/core-fhirpatharraynotequals.html): Home > @medplum/core > fhirPathArrayNotEquals (56 words) - [core.fhircastimagingstudyopencontext | Medplum](/content/docs/sdk/core-fhircastimagingstudyopencontext.html): Home > @medplum/core > FhircastImagingStudyOpenContext (24 words) - [core.findobservationreferenceranges | Medplum](/content/docs/sdk/core-findobservationreferenceranges.html): Home > @medplum/core > findObservationReferenceRanges (56 words) - [core.fhircastupdatescontext | Medplum](/content/docs/sdk/core-fhircastupdatescontext.html): Home > @medplum/core > FhircastUpdatesContext (13 words) - [core.fhirfilternegation | Medplum](/content/docs/sdk/core-fhirfilternegation.html): Home > @medplum/core > FhirFilterNegation (45 words) - [core.fhirpathnot | Medplum](/content/docs/sdk/core-fhirpathnot.html): Home > @medplum/core > fhirPathNot (34 words) - [core.filebuilder.tostring | Medplum](/content/docs/sdk/core-filebuilder-tostring.html): Home > @medplum/core > FileBuilder > toString (9 words) - [core.filebuilder._constructor_ | Medplum](/content/docs/sdk/core-filebuilder-_constructor_.html): Home > @medplum/core > FileBuilder > (constructor) (24 words) - [core.fhirfilterconnective._constructor_ | Medplum](/content/docs/sdk/core-fhirfilterconnective-_constructor_.html): Home > @medplum/core > FhirFilterConnective > (constructor) (30 words) - [core.filebuilder.appendnowrap | Medplum](/content/docs/sdk/core-filebuilder-appendnowrap.html): Home > @medplum/core > FileBuilder > appendNoWrap (17 words) - [core.fhirpathpatchtypedvalue | Medplum](/content/docs/sdk/core-fhirpathpatchtypedvalue.html): Home > @medplum/core > fhirpathPatchTypedValue (24 words) - [core.forbidden | Medplum](/content/docs/sdk/core-forbidden.html): Home > @medplum/core > forbidden (5 words) - [core.fhirfiltercomparison | Medplum](/content/docs/sdk/core-fhirfiltercomparison.html): Home > @medplum/core > FhirFilterComparison (47 words) - [core.fhirpathatom.tostring | Medplum](/content/docs/sdk/core-fhirpathatom-tostring.html): Home > @medplum/core > FhirPathAtom > toString (9 words) - [core.filter.value | Medplum](/content/docs/sdk/core-filter-value.html): Home > @medplum/core > Filter > value (13 words) - [core.fhirpatharrayequivalent | Medplum](/content/docs/sdk/core-fhirpatharrayequivalent.html): Home > @medplum/core > fhirPathArrayEquivalent (45 words) - [core.fhirpathatom.original | Medplum](/content/docs/sdk/core-fhirpathatom-original.html): Home > @medplum/core > FhirPathAtom > original (9 words) - [core.fhirpathis | Medplum](/content/docs/sdk/core-fhirpathis.html): Home > @medplum/core > fhirPathIs (49 words) - [core.extendedinternalschemaelement | Medplum](/content/docs/sdk/core-extendedinternalschemaelement.html): Home > @medplum/core > ExtendedInternalSchemaElement (23 words) - [core.fhircastdisconnectevent | Medplum](/content/docs/sdk/core-fhircastdisconnectevent.html): Home > @medplum/core > FhircastDisconnectEvent (19 words) - [core.fhircastresourcecontext | Medplum](/content/docs/sdk/core-fhircastresourcecontext.html): Home > @medplum/core > FhircastResourceContext (33 words) - [core.filter.code | Medplum](/content/docs/sdk/core-filter-code.html): Home > @medplum/core > Filter > code (7 words) - [core.fhircastdiagnosticreportopencontext | Medplum](/content/docs/sdk/core-fhircastdiagnosticreportopencontext.html): Home > @medplum/core > FhircastDiagnosticReportOpenContext (27 words) - [core.fhirpathatom.child | Medplum](/content/docs/sdk/core-fhirpathatom-child.html): Home > @medplum/core > FhirPathAtom > child (14 words) - [core.fhircastresourceeventname | Medplum](/content/docs/sdk/core-fhircastresourceeventname.html): Home > @medplum/core > FhircastResourceEventName (19 words) - [core.fhirpathatom._constructor_ | Medplum](/content/docs/sdk/core-fhirpathatom-_constructor_.html): Home > @medplum/core > FhirPathAtom > (constructor) (22 words) - [core.fhirfilterconnective.left | Medplum](/content/docs/sdk/core-fhirfilterconnective-left.html): Home > @medplum/core > FhirFilterConnective > left (8 words) - [core.fhircast_event_names | Medplum](/content/docs/sdk/core-fhircast_event_names.html): Home > @medplum/core > FHIRCAST\EVENT\NAMES (41 words) - [core.fhircastreferencecontext | Medplum](/content/docs/sdk/core-fhircastreferencecontext.html): Home > @medplum/core > FhircastReferenceContext (24 words) - [core.fhircaststudycontext | Medplum](/content/docs/sdk/core-fhircaststudycontext.html): Home > @medplum/core > FhircastStudyContext (16 words) - [core.fhirfilterconnective.right | Medplum](/content/docs/sdk/core-fhirfilterconnective-right.html): Home > @medplum/core > FhirFilterConnective > right (9 words) - [core.evalfhirpathtyped | Medplum](/content/docs/sdk/core-evalfhirpathtyped.html): Home > @medplum/core > evalFhirPathTyped (96 words) - [core.fhirfiltercomparison._constructor_ | Medplum](/content/docs/sdk/core-fhirfiltercomparison-_constructor_.html): Home > @medplum/core > FhirFilterComparison > (constructor) (26 words) - [core.fhircastdiagnosticreportupdatecontext | Medplum](/content/docs/sdk/core-fhircastdiagnosticreportupdatecontext.html): Home > @medplum/core > FhircastDiagnosticReportUpdateContext (18 words) - [core.fhirfilternegation.child | Medplum](/content/docs/sdk/core-fhirfilternegation-child.html): Home > @medplum/core > FhirFilterNegation > child (8 words) - [core.fhircastsubscriptioneventmap | Medplum](/content/docs/sdk/core-fhircastsubscriptioneventmap.html): Home > @medplum/core > FhircastSubscriptionEventMap (21 words) - [core.fhircastencounterclosecontext | Medplum](/content/docs/sdk/core-fhircastencounterclosecontext.html): Home > @medplum/core > FhircastEncounterCloseContext (13 words) - [core.fhircastselectcontext | Medplum](/content/docs/sdk/core-fhircastselectcontext.html): Home > @medplum/core > FhircastSelectContext (21 words) - [core.fhirfiltercomparison.path | Medplum](/content/docs/sdk/core-fhirfiltercomparison-path.html): Home > @medplum/core > FhirFilterComparison > path (9 words) - [core.fhircasteventpayload | Medplum](/content/docs/sdk/core-fhircasteventpayload.html): Home > @medplum/core > FhircastEventPayload (29 words) - [core.externalsecretprimitive | Medplum](/content/docs/sdk/core-externalsecretprimitive.html): Home > @medplum/core > ExternalSecretPrimitive (20 words) - [core.extensible | Medplum](/content/docs/sdk/core-extensible.html): Home > @medplum/core > Extensible (56 words) - [core.fhircastpatientreferencecontext | Medplum](/content/docs/sdk/core-fhircastpatientreferencecontext.html): Home > @medplum/core > FhircastPatientReferenceContext (21 words) - [core.eventtarget_2.listenercount | Medplum](/content/docs/sdk/core-eventtarget_2-listenercount.html): Home > @medplum/core > EventTarget\2 > listenerCount (40 words) - [core.fhircasteventversionoptional | Medplum](/content/docs/sdk/core-fhircasteventversionoptional.html): Home > @medplum/core > FhircastEventVersionOptional (15 words) - [core.fhircastresourcetype | Medplum](/content/docs/sdk/core-fhircastresourcetype.html): Home > @medplum/core > FhircastResourceType (19 words) - [core.fhircastencountercontext | Medplum](/content/docs/sdk/core-fhircastencountercontext.html): Home > @medplum/core > FhircastEncounterContext (13 words) - [core.fhircastsyncerrorcontext | Medplum](/content/docs/sdk/core-fhircastsyncerrorcontext.html): Home > @medplum/core > FhircastSyncErrorContext (10 words) - [core.fhircasteventkeys | Medplum](/content/docs/sdk/core-fhircasteventkeys.html): Home > @medplum/core > FhircastEventKeys (18 words) - [core.fhircastmessageevent | Medplum](/content/docs/sdk/core-fhircastmessageevent.html): Home > @medplum/core > FhircastMessageEvent (18 words) - [core.fhircastpatientopencontext | Medplum](/content/docs/sdk/core-fhircastpatientopencontext.html): Home > @medplum/core > FhircastPatientOpenContext (15 words) - [core.fhircastconnection.subrequest | Medplum](/content/docs/sdk/core-fhircastconnection-subrequest.html): Home > @medplum/core > FhircastConnection > subRequest (9 words) - [core.fhircastreportcontext | Medplum](/content/docs/sdk/core-fhircastreportcontext.html): Home > @medplum/core > FhircastReportContext (15 words) - [Health Gorilla Lab Orders | Medplum](/content/docs/integration/health-gorilla/index.html): Health Gorilla is an interoperability service that enables healthcare providers to order lab tests and diagnostics through a unified API. Medplum provides a first-party integration with Health Gorilla in order to optimize this experience, minimizing errors and enhancing the patient experience. (1,601 words) - [core.fhircastdiagnosticreportselectcontext | Medplum](/content/docs/sdk/core-fhircastdiagnosticreportselectcontext.html): Home > @medplum/core > FhircastDiagnosticReportSelectContext (24 words) - [core.fhircastoperationoutcomecontext | Medplum](/content/docs/sdk/core-fhircastoperationoutcomecontext.html): Home > @medplum/core > FhircastOperationOutcomeContext (21 words) - [core.fhircastpatientclosecontext | Medplum](/content/docs/sdk/core-fhircastpatientclosecontext.html): Home > @medplum/core > FhircastPatientCloseContext (13 words) - [core.fetchversionmanifest | Medplum](/content/docs/sdk/core-fetchversionmanifest.html): Home > @medplum/core > fetchVersionManifest (89 words) - [core.extractservicetypereferences | Medplum](/content/docs/sdk/core-extractservicetypereferences.html): Home > @medplum/core > extractServiceTypeReferences (35 words) - [core.fhircastimagingstudyclosecontext | Medplum](/content/docs/sdk/core-fhircastimagingstudyclosecontext.html): Home > @medplum/core > FhircastImagingStudyCloseContext (12 words) - [core.fhircastpatientcontext | Medplum](/content/docs/sdk/core-fhircastpatientcontext.html): Home > @medplum/core > FhircastPatientContext (15 words) - [core.fhircastconnectevent | Medplum](/content/docs/sdk/core-fhircastconnectevent.html): Home > @medplum/core > FhircastConnectEvent (19 words) - [core.eventtarget_2.removeeventlistener | Medplum](/content/docs/sdk/core-eventtarget_2-removeeventlistener.html): Home > @medplum/core > EventTarget\2 > removeEventListener (23 words) - [core.fhircasteventcontextdetails | Medplum](/content/docs/sdk/core-fhircasteventcontextdetails.html): Home > @medplum/core > FhircastEventContextDetails (26 words) - [core.externalsecret | Medplum](/content/docs/sdk/core-externalsecret.html): Home > @medplum/core > ExternalSecret (31 words) - [core.fhircasthubcontentcontext | Medplum](/content/docs/sdk/core-fhircasthubcontentcontext.html): Home > @medplum/core > FhircastHubContentContext (15 words) - [core.fhircastcontextresourcetype | Medplum](/content/docs/sdk/core-fhircastcontextresourcetype.html): Home > @medplum/core > FhircastContextResourceType (36 words) - [core.fhircasteventname | Medplum](/content/docs/sdk/core-fhircasteventname.html): Home > @medplum/core > FhircastEventName (14 words) - [core.eventtarget_2 | Medplum](/content/docs/sdk/core-eventtarget_2.html): Home > @medplum/core > EventTarget\2 (45 words) - [core.extractaccountreferences | Medplum](/content/docs/sdk/core-extractaccountreferences.html): Home > @medplum/core > extractAccountReferences (52 words) - [core.fhircastconnection._constructor_ | Medplum](/content/docs/sdk/core-fhircastconnection-_constructor_.html): Home > @medplum/core > FhircastConnection > (constructor) (22 words) - [core.emptysetatom.tostring | Medplum](/content/docs/sdk/core-emptysetatom-tostring.html): Home > @medplum/core > EmptySetAtom > toString (10 words) - [core.equalsatom._constructor_ | Medplum](/content/docs/sdk/core-equalsatom-_constructor_.html): Home > @medplum/core > EqualsAtom > (constructor) (24 words) - [core.fhircastconnection.disconnect | Medplum](/content/docs/sdk/core-fhircastconnection-disconnect.html): Home > @medplum/core > FhircastConnection > disconnect (10 words) - [core.event_2.type | Medplum](/content/docs/sdk/core-event_2-type.html): Home > @medplum/core > Event\2 > type (14 words) - [core.eventtarget_2.addeventlistener | Medplum](/content/docs/sdk/core-eventtarget_2-addeventlistener.html): Home > @medplum/core > EventTarget\2 > addEventListener (23 words) - [core.fetchlatestversionstring | Medplum](/content/docs/sdk/core-fetchlatestversionstring.html): Home > @medplum/core > fetchLatestVersionString (47 words) - [core.fhircastdiagnosticreportclosecontext | Medplum](/content/docs/sdk/core-fhircastdiagnosticreportclosecontext.html): Home > @medplum/core > FhircastDiagnosticReportCloseContext (12 words) - [core.fhircast_resource_types | Medplum](/content/docs/sdk/core-fhircast_resource_types.html): Home > @medplum/core > FHIRCAST\RESOURCE\TYPES (13 words) - [core.equivalentatom | Medplum](/content/docs/sdk/core-equivalentatom.html): Home > @medplum/core > EquivalentAtom (51 words) - [core.diffarrays | Medplum](/content/docs/sdk/core-diffarrays.html): Home > @medplum/core > diffArrays (189 words) - [core.evalsqlonfhir | Medplum](/content/docs/sdk/core-evalsqlonfhir.html): Home > @medplum/core > evalSqlOnFhir (45 words) - [core.extendedelementproperties | Medplum](/content/docs/sdk/core-extendedelementproperties.html): Home > @medplum/core > ExtendedElementProperties (13 words) - [core.externalsecretsystems | Medplum](/content/docs/sdk/core-externalsecretsystems.html): Home > @medplum/core > ExternalSecretSystems (11 words) - [core.fetchlike | Medplum](/content/docs/sdk/core-fetchlike.html): Home > @medplum/core > FetchLike (15 words) - [core.externalsecretsystem | Medplum](/content/docs/sdk/core-externalsecretsystem.html): Home > @medplum/core > ExternalSecretSystem (14 words) - [core.eventtarget_2.dispatchevent | Medplum](/content/docs/sdk/core-eventtarget_2-dispatchevent.html): Home > @medplum/core > EventTarget\2 > dispatchEvent (17 words) - [core.fhircast_event_version_required | Medplum](/content/docs/sdk/core-fhircast_event_version_required.html): Home > @medplum/core > FHIRCAST\EVENT\VERSION\REQUIRED (6 words) - [core.expandsampleddata | Medplum](/content/docs/sdk/core-expandsampleddata.html): Home > @medplum/core > expandSampledData (17 words) - [core.escapetoken | Medplum](/content/docs/sdk/core-escapetoken.html): Home > @medplum/core > escapeToken (72 words) - [core.equivalentatom._constructor_ | Medplum](/content/docs/sdk/core-equivalentatom-_constructor_.html): Home > @medplum/core > EquivalentAtom > (constructor) (30 words) - [core.expandsampledobservation | Medplum](/content/docs/sdk/core-expandsampledobservation.html): Home > @medplum/core > expandSampledObservation (17 words) - [core.diffany | Medplum](/content/docs/sdk/core-diffany.html): Home > @medplum/core > diffAny (238 words) - [core.extendedinternalschemaelement.readonly | Medplum](/content/docs/sdk/core-extendedinternalschemaelement-readonly.html): Home > @medplum/core > ExtendedInternalSchemaElement > readonly (7 words) - [core.equalsatom | Medplum](/content/docs/sdk/core-equalsatom.html): Home > @medplum/core > EqualsAtom (35 words) - [core.eventtarget_2.removealllisteners | Medplum](/content/docs/sdk/core-eventtarget_2-removealllisteners.html): Home > @medplum/core > EventTarget\2 > removeAllListeners (9 words) - [core.event_2 | Medplum](/content/docs/sdk/core-event_2.html): Home > @medplum/core > Event\2 (18 words) - [core.escapehtml | Medplum](/content/docs/sdk/core-escapehtml.html): Home > @medplum/core > escapeHtml (45 words) - [core.equalsatom.eval | Medplum](/content/docs/sdk/core-equalsatom-eval.html): Home > @medplum/core > EqualsAtom > eval (23 words) - [core.ensurenoleadingslash | Medplum](/content/docs/sdk/core-ensurenoleadingslash.html): Home > @medplum/core > ensureNoLeadingSlash (44 words) - [core.emptysetatom | Medplum](/content/docs/sdk/core-emptysetatom.html): Home > @medplum/core > EmptySetAtom (20 words) - [core.emailpasswordloginrequest | Medplum](/content/docs/sdk/core-emailpasswordloginrequest.html): Home > @medplum/core > EmailPasswordLoginRequest (28 words) - [core.eventtarget_2._constructor_ | Medplum](/content/docs/sdk/core-eventtarget_2-_constructor_.html): Home > @medplum/core > EventTarget\2 > (constructor) (11 words) - [core.createfhircastmessagepayload | Medplum](/content/docs/sdk/core-createfhircastmessagepayload.html): Home > @medplum/core > createFhircastMessagePayload (102 words) - [core.event_2.defaultprevented | Medplum](/content/docs/sdk/core-event_2-defaultprevented.html): Home > @medplum/core > Event\2 > defaultPrevented (8 words) - [core.emptysetatom.eval | Medplum](/content/docs/sdk/core-emptysetatom-eval.html): Home > @medplum/core > EmptySetAtom > eval (9 words) - [core.dotatom | Medplum](/content/docs/sdk/core-dotatom.html): Home > @medplum/core > DotAtom (36 words) - [core.equivalentatom.eval | Medplum](/content/docs/sdk/core-equivalentatom-eval.html): Home > @medplum/core > EquivalentAtom > eval (21 words) - [core.datasampler.summarize | Medplum](/content/docs/sdk/core-datasampler-summarize.html): Home > @medplum/core > DataSampler > summarize (27 words) - [core.deriveidentifiersearchparameter | Medplum](/content/docs/sdk/core-deriveidentifiersearchparameter.html): Home > @medplum/core > deriveIdentifierSearchParameter (90 words) - [core.encodebase64 | Medplum](/content/docs/sdk/core-encodebase64.html): Home > @medplum/core > encodeBase64 (37 words) - [core.dotatom._constructor_ | Medplum](/content/docs/sdk/core-dotatom-_constructor_.html): Home > @medplum/core > DotAtom > (constructor) (24 words) - [core.elementscontexttype | Medplum](/content/docs/sdk/core-elementscontexttype.html): Home > @medplum/core > ElementsContextType (70 words) - [core.deepclone | Medplum](/content/docs/sdk/core-deepclone.html): Home > @medplum/core > deepClone (66 words) - [Modeling a Formulary | Medplum](/content/docs/medications/formulary/index.html): A "formulary" refers to a catalog of drugs offered by your organization. When implementing a custom EMR, Digital Health clinical administrators often curate a formulary of relevant drugs, along with relevant metadata, to assist prescribing physicians, pharmacists, and patients. (1,603 words) - [core.dotatom.eval | Medplum](/content/docs/sdk/core-dotatom-eval.html): Home > @medplum/core > DotAtom > eval (21 words) - [core.errorevent_2.message | Medplum](/content/docs/sdk/core-errorevent_2-message.html): Home > @medplum/core > ErrorEvent\2 > message (7 words) - [core.errorevent_2.error | Medplum](/content/docs/sdk/core-errorevent_2-error.html): Home > @medplum/core > ErrorEvent\2 > error (7 words) - [core.elementtype | Medplum](/content/docs/sdk/core-elementtype.html): Home > @medplum/core > ElementType (22 words) - [core.deepincludes | Medplum](/content/docs/sdk/core-deepincludes.html): Home > @medplum/core > deepIncludes (65 words) - [core.deepequals | Medplum](/content/docs/sdk/core-deepequals.html): Home > @medplum/core > deepEquals (53 words) - [core.encodesmarthealthlink | Medplum](/content/docs/sdk/core-encodesmarthealthlink.html): Home > @medplum/core > encodeSmartHealthLink (20 words) - [core.emailpasswordloginrequest.password | Medplum](/content/docs/sdk/core-emailpasswordloginrequest-password.html): Home > @medplum/core > EmailPasswordLoginRequest > password (9 words) - [core.crawlervisitor | Medplum](/content/docs/sdk/core-crawlervisitor.html): Home > @medplum/core > CrawlerVisitor (68 words) - [core.default_search_count | Medplum](/content/docs/sdk/core-default_search_count.html): Home > @medplum/core > DEFAULT\SEARCH\COUNT (6 words) - [core.emailpasswordloginrequest.email | Medplum](/content/docs/sdk/core-emailpasswordloginrequest-email.html): Home > @medplum/core > EmailPasswordLoginRequest > email (14 words) - [core.ensuretrailingslash | Medplum](/content/docs/sdk/core-ensuretrailingslash.html): Home > @medplum/core > ensureTrailingSlash (37 words) - [core.encodebase64url | Medplum](/content/docs/sdk/core-encodebase64url.html): Home > @medplum/core > encodeBase64Url (39 words) - [core.closeevent_2 | Medplum](/content/docs/sdk/core-closeevent_2.html): Home > @medplum/core > CloseEvent\2 (26 words) - [core.createmediaoptions | Medplum](/content/docs/sdk/core-createmediaoptions.html): Home > @medplum/core > CreateMediaOptions (29 words) - [core.encryptsha256 | Medplum](/content/docs/sdk/core-encryptsha256.html): Home > @medplum/core > encryptSHA256 (33 words) - [core.emailpasswordloginrequest.remember | Medplum](/content/docs/sdk/core-emailpasswordloginrequest-remember.html): Home > @medplum/core > EmailPasswordLoginRequest > remember (19 words) - [core.createpatch | Medplum](/content/docs/sdk/core-createpatch.html): Home > @medplum/core > createPatch (112 words) - [core.elementtype.targetprofile | Medplum](/content/docs/sdk/core-elementtype-targetprofile.html): Home > @medplum/core > ElementType > targetProfile (7 words) - [core.createpreferredpharmacyextension | Medplum](/content/docs/sdk/core-createpreferredpharmacyextension.html): Home > @medplum/core > createPreferredPharmacyExtension (64 words) - [core.datasampler.adddata | Medplum](/content/docs/sdk/core-datasampler-adddata.html): Home > @medplum/core > DataSampler > addData (17 words) - [core.createconstraintissue | Medplum](/content/docs/sdk/core-createconstraintissue.html): Home > @medplum/core > createConstraintIssue (24 words) - [core.diffobjects | Medplum](/content/docs/sdk/core-diffobjects.html): Home > @medplum/core > diffObjects (33 words) - [core.datasampleoptions | Medplum](/content/docs/sdk/core-datasampleoptions.html): Home > @medplum/core > DataSampleOptions (36 words) - [core.createtests | Medplum](/content/docs/sdk/core-createtests.html): Home > @medplum/core > createTests (97 words) - [core.dotatom.tostring | Medplum](/content/docs/sdk/core-dotatom-tostring.html): Home > @medplum/core > DotAtom > toString (10 words) - [core.createpdfoptions | Medplum](/content/docs/sdk/core-createpdfoptions.html): Home > @medplum/core > CreatePdfOptions (53 words) - [core.days_of_week | Medplum](/content/docs/sdk/core-days_of_week.html): Home > @medplum/core > DAYS\OF\WEEK (14 words) - [core.diff | Medplum](/content/docs/sdk/core-diff.html): Home > @medplum/core > Diff (20 words) - [core.empty | Medplum](/content/docs/sdk/core-empty.html): Home > @medplum/core > EMPTY (9 words) - [core.createprocessingissue | Medplum](/content/docs/sdk/core-createprocessingissue.html): Home > @medplum/core > createProcessingIssue (37 words) - [core.countby | Medplum](/content/docs/sdk/core-countby.html): Home > @medplum/core > countBy (84 words) - [core.default_max_search_count | Medplum](/content/docs/sdk/core-default_max_search_count.html): Home > @medplum/core > DEFAULT\MAX\SEARCH\COUNT (6 words) - [core.elementtype.profile | Medplum](/content/docs/sdk/core-elementtype-profile.html): Home > @medplum/core > ElementType > profile (7 words) - [core.datasampler.addobservation | Medplum](/content/docs/sdk/core-datasampler-addobservation.html): Home > @medplum/core > DataSampler > addObservation (14 words) - [core.datasampleoptions.code | Medplum](/content/docs/sdk/core-datasampleoptions-code.html): Home > @medplum/core > DataSampleOptions > code (13 words) - [core.elementtype.code | Medplum](/content/docs/sdk/core-elementtype-code.html): Home > @medplum/core > ElementType > code (7 words) - [core.dayofweek | Medplum](/content/docs/sdk/core-dayofweek.html): Home > @medplum/core > DayOfWeek (14 words) - [core.createbinaryoptions | Medplum](/content/docs/sdk/core-createbinaryoptions.html): Home > @medplum/core > CreateBinaryOptions (72 words) - [Appointment $book | Medplum](/content/docs/scheduling/appointment-book/index.html): The $book operation is currently in beta. (1,064 words) - [core.datasampler._constructor_ | Medplum](/content/docs/sdk/core-datasampler-_constructor_.html): Home > @medplum/core > DataSampler > (constructor) (23 words) - [core.createstructureissue | Medplum](/content/docs/sdk/core-createstructureissue.html): Home > @medplum/core > createStructureIssue (24 words) - [core.decodebase64url | Medplum](/content/docs/sdk/core-decodebase64url.html): Home > @medplum/core > decodeBase64Url (31 words) - [core.createoperationoutcomeissue | Medplum](/content/docs/sdk/core-createoperationoutcomeissue.html): Home > @medplum/core > createOperationOutcomeIssue (39 words) - [core.datasampleoptions.sampling | Medplum](/content/docs/sdk/core-datasampleoptions-sampling.html): Home > @medplum/core > DataSampleOptions > sampling (19 words) - [core.datatypesmap | Medplum](/content/docs/sdk/core-datatypesmap.html): Home > @medplum/core > DataTypesMap (16 words) - [core.createpdfoptions.docdefinition | Medplum](/content/docs/sdk/core-createpdfoptions-docdefinition.html): Home > @medplum/core > CreatePdfOptions > docDefinition (15 words) - [core.crawltypedvalue | Medplum](/content/docs/sdk/core-crawltypedvalue.html): Home > @medplum/core > crawlTypedValue (54 words) - [core.decodebase64 | Medplum](/content/docs/sdk/core-decodebase64.html): Home > @medplum/core > decodeBase64 (38 words) - [core.datasampleoptions.unit | Medplum](/content/docs/sdk/core-datasampleoptions-unit.html): Home > @medplum/core > DataSampleOptions > unit (12 words) - [core.default_accept | Medplum](/content/docs/sdk/core-default_accept.html): Home > @medplum/core > DEFAULT\ACCEPT (5 words) - [core.copy | Medplum](/content/docs/sdk/core-copy.html): Home > @medplum/core > copy (137 words) - [core.criteriastate | Medplum](/content/docs/sdk/core-criteriastate.html): Home > @medplum/core > CriteriaState (18 words) - [core.createpdfoptions.fonts | Medplum](/content/docs/sdk/core-createpdfoptions-fonts.html): Home > @medplum/core > CreatePdfOptions > fonts (19 words) - [core.createpdfoptions.tablelayouts | Medplum](/content/docs/sdk/core-createpdfoptions-tablelayouts.html): Home > @medplum/core > CreatePdfOptions > tableLayouts (15 words) - [core.createmediaoptions.additionalfields | Medplum](/content/docs/sdk/core-createmediaoptions-additionalfields.html): Home > @medplum/core > CreateMediaOptions > additionalFields (15 words) - [core.createdocumentreferenceoptions | Medplum](/content/docs/sdk/core-createdocumentreferenceoptions.html): Home > @medplum/core > CreateDocumentReferenceOptions (27 words) - [core.createbinaryoptions.securitycontext | Medplum](/content/docs/sdk/core-createbinaryoptions-securitycontext.html): Home > @medplum/core > CreateBinaryOptions > securityContext (15 words) - [core.conceptmaptranslateparameters | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters.html): Home > @medplum/core > ConceptMapTranslateParameters (35 words) - [core.createbinaryoptions.filename | Medplum](/content/docs/sdk/core-createbinaryoptions-filename.html): Home > @medplum/core > CreateBinaryOptions > filename (14 words) - [Results and Review | Medplum](/content/docs/labs-imaging/results-and-review/index.html): When a performing laboratory or imaging facility completes a diagnostic study, the results are represented in FHIR as a DiagnosticReport linked to individual Observation resources. This guide covers how results connect back to orders, how to structure them for display, and how to handle abnormal findings. (779 words) - [core.countwhere | Medplum](/content/docs/sdk/core-countwhere.html): Home > @medplum/core > countWhere (36 words) - [core.created | Medplum](/content/docs/sdk/core-created.html): Home > @medplum/core > created (7 words) - [core.contenttype | Medplum](/content/docs/sdk/core-contenttype.html): Home > @medplum/core > ContentType (83 words) - [core.conceptmaptranslatematch | Medplum](/content/docs/sdk/core-conceptmaptranslatematch.html): Home > @medplum/core > ConceptMapTranslateMatch (43 words) - [core.createbinaryoptions.data | Medplum](/content/docs/sdk/core-createbinaryoptions-data.html): Home > @medplum/core > CreateBinaryOptions > data (14 words) - [core.clientstorage | Medplum](/content/docs/sdk/core-clientstorage.html): Home > @medplum/core > ClientStorage (87 words) - [core.converttosearchabletokens | Medplum](/content/docs/sdk/core-converttosearchabletokens.html): Home > @medplum/core > convertToSearchableTokens (22 words) - [core.crawlervisitor.visitproperty | Medplum](/content/docs/sdk/core-crawlervisitor-visitproperty.html): Home > @medplum/core > CrawlerVisitor > visitProperty (21 words) - [core.compresselement | Medplum](/content/docs/sdk/core-compresselement.html): Home > @medplum/core > compressElement (22 words) - [core.containsatom | Medplum](/content/docs/sdk/core-containsatom.html): Home > @medplum/core > ContainsAtom (35 words) - [core.converttosearchableuris | Medplum](/content/docs/sdk/core-converttosearchableuris.html): Home > @medplum/core > convertToSearchableUris (22 words) - [core.codingmatchestoken | Medplum](/content/docs/sdk/core-codingmatchestoken.html): Home > @medplum/core > codingMatchesToken (50 words) - [core.crawlervisitor.onexitresource | Medplum](/content/docs/sdk/core-crawlervisitor-onexitresource.html): Home > @medplum/core > CrawlerVisitor > onExitResource (14 words) - [core.containsatom._constructor_ | Medplum](/content/docs/sdk/core-containsatom-_constructor_.html): Home > @medplum/core > ContainsAtom > (constructor) (22 words) - [core.conceptmaptranslate | Medplum](/content/docs/sdk/core-conceptmaptranslate.html): Home > @medplum/core > conceptMapTranslate (30 words) - [core.converttosearchablereferences | Medplum](/content/docs/sdk/core-converttosearchablereferences.html): Home > @medplum/core > convertToSearchableReferences (20 words) - [core.constraint | Medplum](/content/docs/sdk/core-constraint.html): Home > @medplum/core > Constraint (24 words) - [core.codeableconceptmatchestoken | Medplum](/content/docs/sdk/core-codeableconceptmatchestoken.html): Home > @medplum/core > codeableConceptMatchesToken (50 words) - [core.copyoperation.from | Medplum](/content/docs/sdk/core-copyoperation-from.html): Home > @medplum/core > CopyOperation > from (13 words) - [core.crawleroptions | Medplum](/content/docs/sdk/core-crawleroptions.html): Home > @medplum/core > CrawlerOptions (20 words) - [core.crawlervisitor.onenterresource | Medplum](/content/docs/sdk/core-crawlervisitor-onenterresource.html): Home > @medplum/core > CrawlerVisitor > onEnterResource (15 words) - [core.converttosearchabledates | Medplum](/content/docs/sdk/core-converttosearchabledates.html): Home > @medplum/core > convertToSearchableDates (22 words) - [core.conflict | Medplum](/content/docs/sdk/core-conflict.html): Home > @medplum/core > conflict (25 words) - [core.converttosearchablequantities | Medplum](/content/docs/sdk/core-converttosearchablequantities.html): Home > @medplum/core > convertToSearchableQuantities (20 words) - [core.conceptmaptranslatematchattribute | Medplum](/content/docs/sdk/core-conceptmaptranslatematchattribute.html): Home > @medplum/core > ConceptMapTranslateMatchAttribute (18 words) - [core.conceptmaptranslatematch.concept | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-concept.html): Home > @medplum/core > ConceptMapTranslateMatch > concept (8 words) - [core.conceptmaptranslatematch.property | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-property.html): Home > @medplum/core > ConceptMapTranslateMatch > property (7 words) - [core.crawlervisitor.onenterobject | Medplum](/content/docs/sdk/core-crawlervisitor-onenterobject.html): Home > @medplum/core > CrawlerVisitor > onEnterObject (14 words) - [core.crawleroptions.schema | Medplum](/content/docs/sdk/core-crawleroptions-schema.html): Home > @medplum/core > CrawlerOptions > schema (7 words) - [core.conceptmaptranslateoutput.result | Medplum](/content/docs/sdk/core-conceptmaptranslateoutput-result.html): Home > @medplum/core > ConceptMapTranslateOutput > result (8 words) - [core.contenttoolarge | Medplum](/content/docs/sdk/core-contenttoolarge.html): Home > @medplum/core > contentTooLarge (20 words) - [useSubscription Hook | Medplum](/content/docs/react/use-subscription/index.html): useSubscription creates an in-memory Subscription resource on the Medplum server with the given criteria and calls the (1,301 words) - [core.crawlervisitor.onexitobject | Medplum](/content/docs/sdk/core-crawlervisitor-onexitobject.html): Home > @medplum/core > CrawlerVisitor > onExitObject (12 words) - [core.compareversions | Medplum](/content/docs/sdk/core-compareversions.html): Home > @medplum/core > compareVersions (69 words) - [core.converttotransactionbundle | Medplum](/content/docs/sdk/core-converttotransactionbundle.html): Home > @medplum/core > convertToTransactionBundle (42 words) - [core.concatatom | Medplum](/content/docs/sdk/core-concatatom.html): Home > @medplum/core > ConcatAtom (35 words) - [Medication Code Systems | Medplum](/content/docs/medications/medication-codes/index.html): Introduction (966 words) - [core.copyoperation | Medplum](/content/docs/sdk/core-copyoperation.html): Home > @medplum/core > CopyOperation (17 words) - [core.concatatom.eval | Medplum](/content/docs/sdk/core-concatatom-eval.html): Home > @medplum/core > ConcatAtom > eval (21 words) - [core.crawleroptions.skipmissingproperties | Medplum](/content/docs/sdk/core-crawleroptions-skipmissingproperties.html): Home > @medplum/core > CrawlerOptions > skipMissingProperties (7 words) - [core.clientstorage.getstring | Medplum](/content/docs/sdk/core-clientstorage-getstring.html): Home > @medplum/core > ClientStorage > getString (21 words) - [core.conceptmaptranslateparameters.targetsystem | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-targetsystem.html): Home > @medplum/core > ConceptMapTranslateParameters > targetsystem (7 words) - [core.code.code | Medplum](/content/docs/sdk/core-code-code.html): Home > @medplum/core > Code > code (7 words) - [core.closeevent_2.code | Medplum](/content/docs/sdk/core-closeevent_2-code.html): Home > @medplum/core > CloseEvent\2 > code (7 words) - [core.clientstorage.setobject | Medplum](/content/docs/sdk/core-clientstorage-setobject.html): Home > @medplum/core > ClientStorage > setObject (23 words) - [core.copyoperation.path | Medplum](/content/docs/sdk/core-copyoperation-path.html): Home > @medplum/core > CopyOperation > path (7 words) - [core.containsatom.eval | Medplum](/content/docs/sdk/core-containsatom-eval.html): Home > @medplum/core > ContainsAtom > eval (18 words) - [core.conceptmaptranslateoutput | Medplum](/content/docs/sdk/core-conceptmaptranslateoutput.html): Home > @medplum/core > ConceptMapTranslateOutput (19 words) - [core.converttosearchablestrings | Medplum](/content/docs/sdk/core-converttosearchablestrings.html): Home > @medplum/core > convertToSearchableStrings (17 words) - [core.cpt | Medplum](/content/docs/sdk/core-cpt.html): Home > @medplum/core > CPT (8 words) - [core.concaturls | Medplum](/content/docs/sdk/core-concaturls.html): Home > @medplum/core > concatUrls (56 words) - [core.converttosearchablenumbers | Medplum](/content/docs/sdk/core-converttosearchablenumbers.html): Home > @medplum/core > convertToSearchableNumbers (27 words) - [core.cdsupdateaction | Medplum](/content/docs/sdk/core-cdsupdateaction.html): Home > @medplum/core > CdsUpdateAction (43 words) - [core.constraint.key | Medplum](/content/docs/sdk/core-constraint-key.html): Home > @medplum/core > Constraint > key (8 words) - [core.copyoperation.op | Medplum](/content/docs/sdk/core-copyoperation-op.html): Home > @medplum/core > CopyOperation > op (7 words) - [core.constraint.expression | Medplum](/content/docs/sdk/core-constraint-expression.html): Home > @medplum/core > Constraint > expression (13 words) - [core.constraint.severity | Medplum](/content/docs/sdk/core-constraint-severity.html): Home > @medplum/core > Constraint > severity (9 words) - [core.conceptmaptranslatematchattribute.value | Medplum](/content/docs/sdk/core-conceptmaptranslatematchattribute-value.html): Home > @medplum/core > ConceptMapTranslateMatchAttribute > value (7 words) - [core.clientstorage.setstring | Medplum](/content/docs/sdk/core-clientstorage-setstring.html): Home > @medplum/core > ClientStorage > setString (24 words) - [core.clientstorage.makekey | Medplum](/content/docs/sdk/core-clientstorage-makekey.html): Home > @medplum/core > ClientStorage > makeKey (23 words) - [core.codechallengemethod | Medplum](/content/docs/sdk/core-codechallengemethod.html): Home > @medplum/core > CodeChallengeMethod (20 words) - [core.conceptmaptranslatematch.product | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-product.html): Home > @medplum/core > ConceptMapTranslateMatch > product (7 words) - [core.conceptmaptranslateparameters.system | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-system.html): Home > @medplum/core > ConceptMapTranslateParameters > system (8 words) - [core.code | Medplum](/content/docs/sdk/core-code.html): Home > @medplum/core > Code (17 words) - [Claim Submission | Medplum](/content/docs/integration/candid/claim-submission/index.html): This guide explains how to model your FHIR resources for the Candid Health integration to submit professional medical claims. (1,680 words) - [core.clientstorage.getobject | Medplum](/content/docs/sdk/core-clientstorage-getobject.html): Home > @medplum/core > ClientStorage > getObject (21 words) - [core.conceptmaptranslatematch.source | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-source.html): Home > @medplum/core > ConceptMapTranslateMatch > source (8 words) - [core.clientstorage._constructor_ | Medplum](/content/docs/sdk/core-clientstorage-_constructor_.html): Home > @medplum/core > ClientStorage > (constructor) (26 words) - [core.concatatom._constructor_ | Medplum](/content/docs/sdk/core-concatatom-_constructor_.html): Home > @medplum/core > ConcatAtom > (constructor) (22 words) - [core.conceptmaptranslateparameters.source | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-source.html): Home > @medplum/core > ConceptMapTranslateParameters > source (7 words) - [core.closeevent_2.reason | Medplum](/content/docs/sdk/core-closeevent_2-reason.html): Home > @medplum/core > CloseEvent\2 > reason (13 words) - [core.clientstorage.clear | Medplum](/content/docs/sdk/core-clientstorage-clear.html): Home > @medplum/core > ClientStorage > clear (10 words) - [core.conceptmaptranslatematchattribute.key | Medplum](/content/docs/sdk/core-conceptmaptranslatematchattribute-key.html): Home > @medplum/core > ConceptMapTranslateMatchAttribute > key (7 words) - [core.conceptmaptranslatematch.dependson | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-dependson.html): Home > @medplum/core > ConceptMapTranslateMatch > dependsOn (8 words) - [Messaging & Communications Decision Guide | Medplum](/content/docs/decision-guides/messaging/index.html): Companion to the Messaging & Communications docs. (1,809 words) - [core.conceptmaptranslateparameters.codeableconcept | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-codeableconcept.html): Home > @medplum/core > ConceptMapTranslateParameters > codeableConcept (7 words) - [core.checkifvalidmedplumversion | Medplum](/content/docs/sdk/core-checkifvalidmedplumversion.html): Home > @medplum/core > checkIfValidMedplumVersion (74 words) - [Professional Claims Submission (837P) | Medplum](/content/docs/integration/stedi/claim-submission/professional-claims/index.html): This guide explains how to model FHIR resources and invoke the Stedi integration to submit professional (X12 837P) claims to payers. (1,101 words) - [Converting Data to FHIR | Medplum](/content/docs/migration/convert-to-fhir/index.html): [patient]: /docs/api/fhir/resources/patient (1,343 words) - [core.clientloglevel | Medplum](/content/docs/sdk/core-clientloglevel.html): Home > @medplum/core > ClientLogLevel (45 words) - [Representing Prescriptions and Medication Orders | Medplum](/content/docs/medications/representing-prescriptions-and-medication-orders/index.html): Prescriptions and medication orders are very common in healthcare settings and accuracy is vitally important. This guide will go over how to represent all aspects of a medication order, from the request to the administration instructions. Note that this is an operational counterpart to the Modeling A Formulary documentation. (1,430 words) - [RCM & Billing Decision Guide | Medplum](/content/docs/decision-guides/rcm-billing/index.html): Companion to the Billing docs. (3,197 words) - [core.closeevent_2.wasclean | Medplum](/content/docs/sdk/core-closeevent_2-wasclean.html): Home > @medplum/core > CloseEvent\2 > wasClean (7 words) - [core.clearreleasecache | Medplum](/content/docs/sdk/core-clearreleasecache.html): Home > @medplum/core > clearReleaseCache (19 words) - [core.cdssuggestion.uuid | Medplum](/content/docs/sdk/core-cdssuggestion-uuid.html): Home > @medplum/core > CdsSuggestion > uuid (14 words) - [core.checkfornull | Medplum](/content/docs/sdk/core-checkfornull.html): Home > @medplum/core > checkForNull (67 words) - [core.cdsuserresource | Medplum](/content/docs/sdk/core-cdsuserresource.html): Home > @medplum/core > CdsUserResource (18 words) - [core.cdssuggestion | Medplum](/content/docs/sdk/core-cdssuggestion.html): Home > @medplum/core > CdsSuggestion (37 words) - [core.cdsupdateaction.type | Medplum](/content/docs/sdk/core-cdsupdateaction-type.html): Home > @medplum/core > CdsUpdateAction > type (8 words) - [Appointment $hold | Medplum](/content/docs/scheduling/appointment-hold/index.html): The $hold operation is currently in beta. (994 words) - [core.cdsupdateaction.description | Medplum](/content/docs/sdk/core-cdsupdateaction-description.html): Home > @medplum/core > CdsUpdateAction > description (8 words) - [core.buildelementscontext | Medplum](/content/docs/sdk/core-buildelementscontext.html): Home > @medplum/core > buildElementsContext (67 words) - [core.cdssuggestion.actions | Medplum](/content/docs/sdk/core-cdssuggestion-actions.html): Home > @medplum/core > CdsSuggestion > actions (9 words) - [core.cdsupdateaction.resource | Medplum](/content/docs/sdk/core-cdsupdateaction-resource.html): Home > @medplum/core > CdsUpdateAction > resource (8 words) - [core.cdssource.label | Medplum](/content/docs/sdk/core-cdssource-label.html): Home > @medplum/core > CdsSource > label (14 words) - [core.cdssource | Medplum](/content/docs/sdk/core-cdssource.html): Home > @medplum/core > CdsSource (38 words) - [core.cdsservice | Medplum](/content/docs/sdk/core-cdsservice.html): Home > @medplum/core > CdsService (58 words) - [core.cdsservice.description | Medplum](/content/docs/sdk/core-cdsservice-description.html): Home > @medplum/core > CdsService > description (8 words) - [core.cdsresponse.systemactions | Medplum](/content/docs/sdk/core-cdsresponse-systemactions.html): Home > @medplum/core > CdsResponse > systemActions (14 words) - [core.cdsservice.title | Medplum](/content/docs/sdk/core-cdsservice-title.html): Home > @medplum/core > CdsService > title (8 words) - [Scheduling | Medplum](/content/docs/scheduling/index.html): Medplum Scheduling is currently in beta. (887 words) - [core.cdslink.appcontext | Medplum](/content/docs/sdk/core-cdslink-appcontext.html): Home > @medplum/core > CdsLink > appContext (8 words) - [core.cdsservice.usagerequirements | Medplum](/content/docs/sdk/core-cdsservice-usagerequirements.html): Home > @medplum/core > CdsService > usageRequirements (9 words) - [core.cdssource.icon | Medplum](/content/docs/sdk/core-cdssource-icon.html): Home > @medplum/core > CdsSource > icon (14 words) - [core.cdsservice.id | Medplum](/content/docs/sdk/core-cdsservice-id.html): Home > @medplum/core > CdsService > id (8 words) - [core.cdssource.topic | Medplum](/content/docs/sdk/core-cdssource-topic.html): Home > @medplum/core > CdsSource > topic (9 words) - [Message Response Tracking and Routing | Medplum](/content/docs/communications/message-response-tracking-and-routing/index.html): When messages need responses — and those responses need to be tracked, assigned, and rerouted — use the FHIR Task resource alongside Communication. This separates message content (Communication) from the routing and assignment lifecycle (Task), allowing you to reassign work without modifying conversation data. (1,158 words) - [core.cdsrequestwithauth | Medplum](/content/docs/sdk/core-cdsrequestwithauth.html): Home > @medplum/core > CdsRequestWithAuth (29 words) - [core.cdsservice.hook | Medplum](/content/docs/sdk/core-cdsservice-hook.html): Home > @medplum/core > CdsService > hook (8 words) - [E-Prescribe (eRx) | Medplum](/content/docs/medications/e-prescibe/index.html): Medplum allows enabling e-prescribe(eRx) functionality. Medplum's e-prescribe functionality is exclusively available to providers directly engaged in patient care as part of Medplum EHR. (330 words) - [core.cdssource.url | Medplum](/content/docs/sdk/core-cdssource-url.html): Home > @medplum/core > CdsSource > url (9 words) - [Claim Responses (277 / 835) | Medplum](/content/docs/integration/stedi/claim-submission/claim-responses/index.html): This guide explains how Medplum ingests Stedi inbound claim responses — 277CA claim acknowledgments and 835 Electronic Remittance Advice (ERA) — and how to set up the two delivery paths: webhooks (the primary, near-real-time path) and an optional poller (a catch-up safety net). (971 words) - [Appointment $find | Medplum](/content/docs/scheduling/appointment-find/index.html): The $find operation is currently in beta. (786 words) - [Order Labs and Imaging | Medplum](/content/docs/labs-imaging/ordering-labs-imaging/index.html): This guide covers how to order laboratory tests and imaging studies using Medplum, from building order forms through tracking results. For the FHIR data model overview, see Labs & Imaging. For medication ordering, see the Medications section. (890 words) - [core.cdsservice.prefetch | Medplum](/content/docs/sdk/core-cdsservice-prefetch.html): Home > @medplum/core > CdsService > prefetch (10 words) - [Family Relationships | Medplum](/content/docs/fhir-datastore/family-relationships/index.html): Introduction (2,184 words) - [FHIR Basics | Medplum](/content/docs/fhir-basics/index.html): [patient]: /docs/api/fhir/resources/patient (1,488 words) - [core.cdsfhirauthorization.access_token | Medplum](/content/docs/sdk/core-cdsfhirauthorization-access_token.html): Home > @medplum/core > CdsFhirAuthorization > access\token (8 words) - [core.cdslink | Medplum](/content/docs/sdk/core-cdslink.html): Home > @medplum/core > CdsLink (41 words) - [core.cdsrequest | Medplum](/content/docs/sdk/core-cdsrequest.html): Home > @medplum/core > CdsRequest (51 words) - [GraphQL | Medplum](/content/docs/graphql/index.html): Medplum supports the FHIR GraphQL API for creating, updating and searching FHIR resources. (1,954 words) - [core.cdssuggestion.isrecommended | Medplum](/content/docs/sdk/core-cdssuggestion-isrecommended.html): Home > @medplum/core > CdsSuggestion > isRecommended (8 words) - [core.cdslink.label | Medplum](/content/docs/sdk/core-cdslink-label.html): Home > @medplum/core > CdsLink > label (14 words) - [core.cdsfhirauthorization.token_type | Medplum](/content/docs/sdk/core-cdsfhirauthorization-token_type.html): Home > @medplum/core > CdsFhirAuthorization > token\type (9 words) - [core.cdsfhirauthorization.scope | Medplum](/content/docs/sdk/core-cdsfhirauthorization-scope.html): Home > @medplum/core > CdsFhirAuthorization > scope (9 words) - [core.cdsrequestwithauth.fhirserver | Medplum](/content/docs/sdk/core-cdsrequestwithauth-fhirserver.html): Home > @medplum/core > CdsRequestWithAuth > fhirServer (8 words) - [Rate Limits | Medplum](/content/docs/rate-limits/index.html): The Medplum API uses a number of safeguards against bursts of incoming traffic to help maximize its stability. Users who (1,104 words) - [core.cdsresponse | Medplum](/content/docs/sdk/core-cdsresponse.html): Home > @medplum/core > CdsResponse (42 words) - [Parsing Questionnaire Responses | Medplum](/content/docs/questionnaires/parsing-questionnaire-responses/index.html): A QuestionnaireResponse captures what a patient or clinician submitted. Downstream systems – analytics, search, CDS, exchange – usually need that turned into concrete FHIR resources: Observation, Condition, orders, and similar. This applies across charting, intake, registration, prior authorization, and other workflows. (983 words) - [core.cdsfhirauthorization.subject | Medplum](/content/docs/sdk/core-cdsfhirauthorization-subject.html): Home > @medplum/core > CdsFhirAuthorization > subject (9 words) - [core.cdslink.autolaunchable | Medplum](/content/docs/sdk/core-cdslink-autolaunchable.html): Home > @medplum/core > CdsLink > autolaunchable (9 words) - [core.cdsrequest.hook | Medplum](/content/docs/sdk/core-cdsrequest-hook.html): Home > @medplum/core > CdsRequest > hook (8 words) - [core.cdsrequest.hookinstance | Medplum](/content/docs/sdk/core-cdsrequest-hookinstance.html): Home > @medplum/core > CdsRequest > hookInstance (14 words) - [core.canwriteresourcetype | Medplum](/content/docs/sdk/core-canwriteresourcetype.html): Home > @medplum/core > canWriteResourceType (90 words) - [Sending SMS | Medplum](/content/docs/integration/twilio-sms/sending-sms/index.html): Pass the Communication resource inline in the request body. The operation creates a new Communication in Medplum after sending. (421 words) - [core.cdsrequestwithauth.fhirauthorization | Medplum](/content/docs/sdk/core-cdsrequestwithauth-fhirauthorization.html): Home > @medplum/core > CdsRequestWithAuth > fhirAuthorization (9 words) - [core.cdsdiscoveryresponse | Medplum](/content/docs/sdk/core-cdsdiscoveryresponse.html): Home > @medplum/core > CdsDiscoveryResponse (28 words) - [core.cdsresponse.cards | Medplum](/content/docs/sdk/core-cdsresponse-cards.html): Home > @medplum/core > CdsResponse > cards (8 words) - [Beta Changelog | Medplum](/content/docs/scheduling/beta-changelog/index.html): Medplum Scheduling APIs are currently in beta. While in beta, we (662 words) - [Appointment $confirm | Medplum](/content/docs/scheduling/appointment-confirm/index.html): The $confirm operation is currently in beta. (442 words) - [core.businessrule | Medplum](/content/docs/sdk/core-businessrule.html): Home > @medplum/core > businessRule (30 words) - [core.cdslink.url | Medplum](/content/docs/sdk/core-cdslink-url.html): Home > @medplum/core > CdsLink > url (8 words) - [Time Zones and Timestamps | Medplum](/content/docs/scheduling/timezones/index.html): Handling time correctly in distributed systems can be surprisingly complex. Differences in time zones, daylight saving time transitions, and system clock configuration can introduce subtle bugs if timestamps are not handled consistently. (710 words) - [core.cdsrequest.prefetch | Medplum](/content/docs/sdk/core-cdsrequest-prefetch.html): Home > @medplum/core > CdsRequest > prefetch (9 words) - [core.cdsrequest.context | Medplum](/content/docs/sdk/core-cdsrequest-context.html): Home > @medplum/core > CdsRequest > context (10 words) - [Using Tasks to Manage Clinical Workflow | Medplum](/content/docs/careplans/tasks/index.html): Workflow management is an essential part of healthcare, and healthcare operations requiring coordination of many manual steps physicians, patients, nurses, care coordinators, etc. Generally, our goals are to (399 words) - [Order Medication | Medplum](/content/docs/integration/scriptsure/order-medication/index.html): React hook: useScriptSureOrderMedication (804 words) - [core.cdscard.indicator | Medplum](/content/docs/sdk/core-cdscard-indicator.html): Home > @medplum/core > CdsCard > indicator (12 words) - [core.cdscard | Medplum](/content/docs/sdk/core-cdscard.html): Home > @medplum/core > CdsCard (64 words) - [core.cdsfhirauthorization.expires_in | Medplum](/content/docs/sdk/core-cdsfhirauthorization-expires_in.html): Home > @medplum/core > CdsFhirAuthorization > expires\in (9 words) - [Insurance and Benefits Eligibility Checks | Medplum](/content/docs/integration/stedi/insurance-eligibility/eligibility-checks/index.html): This guide explains how to model your FHIR resources for the Stedi integration to send and receive eligibility and benefits checks. (613 words) - [core.cdslink.type | Medplum](/content/docs/sdk/core-cdslink-type.html): Home > @medplum/core > CdsLink > type (12 words) - [core.buildmedicationrequestresponseloststatusreason | Medplum](/content/docs/sdk/core-buildmedicationrequestresponseloststatusreason.html): Home > @medplum/core > buildMedicationRequestResponseLostStatusReason (70 words) - [core.botresponsestream.startstreaming | Medplum](/content/docs/sdk/core-botresponsestream-startstreaming.html): Home > @medplum/core > BotResponseStream > startStreaming (57 words) - [Spaces | Medplum](/content/docs/provider/spaces/index.html): Spaces is the in-app AI assistant in Medplum Provider. A user types a question in natural language; under the hood a chain of Medplum bots translates the question into FHIR API calls, executes them against the project, summarizes the results in the chat, and optionally renders a generated chart inside the same view. (959 words) - [core.cdsdiscoveryresponse.services | Medplum](/content/docs/sdk/core-cdsdiscoveryresponse-services.html): Home > @medplum/core > CdsDiscoveryResponse > services (8 words) - [core.cdsfhirauthorization | Medplum](/content/docs/sdk/core-cdsfhirauthorization.html): Home > @medplum/core > CdsFhirAuthorization (33 words) - [core.calculateage | Medplum](/content/docs/sdk/core-calculateage.html): Home > @medplum/core > calculateAge (75 words) - [core.cdsaction | Medplum](/content/docs/sdk/core-cdsaction.html): Home > @medplum/core > CdsAction (32 words) - [core.buildcdsrequest | Medplum](/content/docs/sdk/core-buildcdsrequest.html): Home > @medplum/core > buildCdsRequest (59 words) - [core.botevent | Medplum](/content/docs/sdk/core-botevent.html): Home > @medplum/core > BotEvent (56 words) - [core.botevent.responsestream | Medplum](/content/docs/sdk/core-botevent-responsestream.html): Home > @medplum/core > BotEvent > responseStream (18 words) - [core.cdscreateaction.resource | Medplum](/content/docs/sdk/core-cdscreateaction-resource.html): Home > @medplum/core > CdsCreateAction > resource (8 words) - [Prescriber Enrollment | Medplum](/content/docs/integration/dosespot/enroll-user/index.html): This guide explains how to enroll a new prescriber in DoseSpot. Medplum provides two enrollment bots: (1,403 words) - [core.cdsdeleteaction.description | Medplum](/content/docs/sdk/core-cdsdeleteaction-description.html): Home > @medplum/core > CdsDeleteAction > description (14 words) - [Threading | Medplum](/content/docs/integration/twilio-sms/threading/index.html): Threading is not handled automatically by the integration — messages arrive and are sent as standalone Communication resources. This is intentional: the right threading strategy depends on your application (patient+practitioner scope, phone-pair scope, a shared inbox, etc.). (359 words) - [core.cdscard.summary | Medplum](/content/docs/sdk/core-cdscard-summary.html): Home > @medplum/core > CdsCard > summary (8 words) - [core.cdsdeleteaction | Medplum](/content/docs/sdk/core-cdsdeleteaction.html): Home > @medplum/core > CdsDeleteAction (32 words) - [core.cdscreateaction.description | Medplum](/content/docs/sdk/core-cdscreateaction-description.html): Home > @medplum/core > CdsCreateAction > description (8 words) - [core.canwriteresource | Medplum](/content/docs/sdk/core-canwriteresource.html): Home > @medplum/core > canWriteResource (71 words) - [core.cdscreateaction | Medplum](/content/docs/sdk/core-cdscreateaction.html): Home > @medplum/core > CdsCreateAction (43 words) - [core.cdsdeleteaction.type | Medplum](/content/docs/sdk/core-cdsdeleteaction-type.html): Home > @medplum/core > CdsDeleteAction > type (9 words) - [core.cdscard.detail | Medplum](/content/docs/sdk/core-cdscard-detail.html): Home > @medplum/core > CdsCard > detail (8 words) - [core.baseloginrequest | Medplum](/content/docs/sdk/core-baseloginrequest.html): Home > @medplum/core > BaseLoginRequest (54 words) - [Medication Cart | Medplum](/content/docs/integration/scriptsure/medication-cart/index.html): The MedCart flow lets a clinician stage several prescriptions during one encounter and approve them all in a single signing session—instead of opening a separate widget per drug. The flow is: (757 words) - [core.cdscreateaction.type | Medplum](/content/docs/sdk/core-cdscreateaction-type.html): Home > @medplum/core > CdsCreateAction > type (14 words) - [core.cdsdeleteaction.resourceid | Medplum](/content/docs/sdk/core-cdsdeleteaction-resourceid.html): Home > @medplum/core > CdsDeleteAction > resourceId (9 words) - [Labs & Imaging | Medplum](/content/docs/labs-imaging/index.html): Lab orders and imaging results in FHIR follow a request-and-report pattern. A ServiceRequest represents the order, and a DiagnosticReport captures the results. Individual measurements are stored as Observation resources linked to the report. (316 words) - [core.cdscard.uuid | Medplum](/content/docs/sdk/core-cdscard-uuid.html): Home > @medplum/core > CdsCard > uuid (9 words) - [core.backgroundjobcontext.interaction | Medplum](/content/docs/sdk/core-backgroundjobcontext-interaction.html): Home > @medplum/core > BackgroundJobContext > interaction (7 words) - [Matching Patients to Providers by State-by-State Licensure | Medplum](/content/docs/scheduling/state-by-state-licensure/index.html): Medplum Scheduling is intentionally designed to allow business specific use cases like state-by-state licensure, program enrollment, and “which providers may this patient book?” to be handled outside Medplum’s scheduling operations. $find does not take a patient, a license, or a state; it only computes free slots for specific Schedule resources you already identified. (599 words) - [core.cdscard.suggestions | Medplum](/content/docs/sdk/core-cdscard-suggestions.html): Home > @medplum/core > CdsCard > suggestions (8 words) - [core.calculateagestring | Medplum](/content/docs/sdk/core-calculateagestring.html): Home > @medplum/core > calculateAgeString (104 words) - [core.canbepopulated | Medplum](/content/docs/sdk/core-canbepopulated.html): Home > @medplum/core > CanBePopulated (16 words) - [core.cdscard.source | Medplum](/content/docs/sdk/core-cdscard-source.html): Home > @medplum/core > CdsCard > source (9 words) - [core.capitalize | Medplum](/content/docs/sdk/core-capitalize.html): Home > @medplum/core > capitalize (20 words) - [core.botevent.bot | Medplum](/content/docs/sdk/core-botevent-bot.html): Home > @medplum/core > BotEvent > bot (14 words) - [Receiving Results | Medplum](/content/docs/integration/health-gorilla/receiving-results/index.html): This guide explains how laboratory results are handled in the Medplum-Health Gorilla labs integration. (1,300 words) - [core.cdscard.links | Medplum](/content/docs/sdk/core-cdscard-links.html): Home > @medplum/core > CdsCard > links (8 words) - [React Components | Medplum](/content/docs/react/index.html): Medplum maintains a library of React components which we use in the Medplum app and are open source. We support use of our React component library in third party apps as well. (433 words) - [core.botresponsestream | Medplum](/content/docs/sdk/core-botresponsestream.html): Home > @medplum/core > BotResponseStream (49 words) - [core.baseschema | Medplum](/content/docs/sdk/core-baseschema.html): Home > @medplum/core > BaseSchema (23 words) - [ValueSet | Medplum](/content/docs/api/fhir/resources/valueset/index.html): A ValueSet resource instance specifies a set of codes drawn from one or more code systems, intended for use in a particular context. Value sets link between CodeSystem definitions and their use in coded elements. (3,565 words) - [Adoption Strategy | Medplum](/content/docs/migration/adoption-strategy/index.html): When migrating existing provider/patient apps to Medplum, a phased approach allows for a smoother transition, minimizes risk, and provides opportunities for validation at each step. This section outlines the recommended phases for migration, along with their rationales and best practices. (766 words) - [core.botevent.headers | Medplum](/content/docs/sdk/core-botevent-headers.html): Home > @medplum/core > BotEvent > headers (29 words) - [core.buildtypename | Medplum](/content/docs/sdk/core-buildtypename.html): Home > @medplum/core > buildTypeName (20 words) - [core.botevent.traceid | Medplum](/content/docs/sdk/core-botevent-traceid.html): Home > @medplum/core > BotEvent > traceId (8 words) - [Tasks | Medplum](/content/docs/provider/tasks/index.html): The Tasks section serves as a centralized management system for coordinating patient care activities across your entire clinical and administrative team. Tasks enable providers, nurses, and support staff to create, assign, track, and complete action items related to patient care, follow-ups, administrative duties, and/or operational workflows. (709 words) - [core.baseagentmessage.type | Medplum](/content/docs/sdk/core-baseagentmessage-type.html): Home > @medplum/core > BaseAgentMessage > type (7 words) - [core.botevent.secrets | Medplum](/content/docs/sdk/core-botevent-secrets.html): Home > @medplum/core > BotEvent > secrets (15 words) - [Processing Asynchronous Bundles | Medplum](/content/docs/fhir-datastore/processing-async-bundles/index.html): Asynchronous batch processing requires the async-batch feature flag on your Medplum Project. For Medplum-hosted environments, contact support@medplum.com to have it enabled. (976 words) - [core.booleantotypedvalue | Medplum](/content/docs/sdk/core-booleantotypedvalue.html): Home > @medplum/core > booleanToTypedValue (44 words) - [core.botevent.requester | Medplum](/content/docs/sdk/core-botevent-requester.html): Home > @medplum/core > BotEvent > requester (22 words) - [core.baseloginrequest.resourcetype | Medplum](/content/docs/sdk/core-baseloginrequest-resourcetype.html): Home > @medplum/core > BaseLoginRequest > resourceType (8 words) - [core.botevent.contenttype | Medplum](/content/docs/sdk/core-botevent-contenttype.html): Home > @medplum/core > BotEvent > contentType (8 words) - [core.baseagentrequestmessage | Medplum](/content/docs/sdk/core-baseagentrequestmessage.html): Home > @medplum/core > BaseAgentRequestMessage (23 words) - [core.botevent.input | Medplum](/content/docs/sdk/core-botevent-input.html): Home > @medplum/core > BotEvent > input (6 words) - [core.baseloginrequest.launch | Medplum](/content/docs/sdk/core-baseloginrequest-launch.html): Home > @medplum/core > BaseLoginRequest > launch (8 words) - [core.baseloginrequest.projectid | Medplum](/content/docs/sdk/core-baseloginrequest-projectid.html): Home > @medplum/core > BaseLoginRequest > projectId (9 words) - [core.backgroundjobcontext | Medplum](/content/docs/sdk/core-backgroundjobcontext.html): Home > @medplum/core > BackgroundJobContext (21 words) - [core.baseloginrequest.googleclientid | Medplum](/content/docs/sdk/core-baseloginrequest-googleclientid.html): Home > @medplum/core > BaseLoginRequest > googleClientId (9 words) - [core.binarysource | Medplum](/content/docs/sdk/core-binarysource.html): Home > @medplum/core > BinarySource (21 words) - [core.baseloginrequest.scope | Medplum](/content/docs/sdk/core-baseloginrequest-scope.html): Home > @medplum/core > BaseLoginRequest > scope (8 words) - [core.baseagentmessage | Medplum](/content/docs/sdk/core-baseagentmessage.html): Home > @medplum/core > BaseAgentMessage (30 words) - [core.addpreferredpharmacytopatient | Medplum](/content/docs/sdk/core-addpreferredpharmacytopatient.html): Home > @medplum/core > addPreferredPharmacyToPatient (99 words) - [core.baseloginrequest.codechallengemethod | Medplum](/content/docs/sdk/core-baseloginrequest-codechallengemethod.html): Home > @medplum/core > BaseLoginRequest > codeChallengeMethod (8 words) - [core.baseloginrequest.clientid | Medplum](/content/docs/sdk/core-baseloginrequest-clientid.html): Home > @medplum/core > BaseLoginRequest > clientId (9 words) - [core.baseloginrequest.redirecturi | Medplum](/content/docs/sdk/core-baseloginrequest-redirecturi.html): Home > @medplum/core > BaseLoginRequest > redirectUri (9 words) - [core.baseloginrequest.nonce | Medplum](/content/docs/sdk/core-baseloginrequest-nonce.html): Home > @medplum/core > BaseLoginRequest > nonce (6 words) - [core.badrequest | Medplum](/content/docs/sdk/core-badrequest.html): Home > @medplum/core > badRequest (29 words) - [core.baseloginrequest.codechallenge | Medplum](/content/docs/sdk/core-baseloginrequest-codechallenge.html): Home > @medplum/core > BaseLoginRequest > codeChallenge (8 words) - [Sending Orders | Medplum](/content/docs/integration/health-gorilla/sending-orders/index.html): For a vendor-neutral overview of diagnostic ordering concepts and the FHIR data model, see Labs & Imaging and Order Labs and Imaging. (1,495 words) - [core.baseagentrequestmessage.accesstoken | Medplum](/content/docs/sdk/core-baseagentrequestmessage-accesstoken.html): Home > @medplum/core > BaseAgentRequestMessage > accessToken (7 words) - [core.backgroundjobinteraction | Medplum](/content/docs/sdk/core-backgroundjobinteraction.html): Home > @medplum/core > BackgroundJobInteraction (20 words) - [Multilingual Support | Medplum](/content/docs/fhir-datastore/multilingual-support/index.html): FHIR provides a standard mechanism for attaching translations to any string field in a resource: the (1,251 words) - [core.baseagentmessage.callback | Medplum](/content/docs/sdk/core-baseagentmessage-callback.html): Home > @medplum/core > BaseAgentMessage > callback (13 words) - [Sync a Provider | Medplum](/content/docs/integration/scriptsure/sync-provider/index.html): Before a prescriber can use ScriptSure, they must have a ScriptSure user account linked to their Medplum ProjectMembership. There are two ways to accomplish this: (584 words) - [Integration | Medplum](/content/docs/integration/index.html): Medplum's integrations the most commonly used features of the platform, and the tools can be used to build effective robust integrations. Medplum supports three types of integrations: (740 words) - [core.atomcontext.parent | Medplum](/content/docs/sdk/core-atomcontext-parent.html): Home > @medplum/core > AtomContext > parent (8 words) - [core.atomcontext | Medplum](/content/docs/sdk/core-atomcontext.html): Home > @medplum/core > AtomContext (18 words) - [core.agentlogsresponse.logs | Medplum](/content/docs/sdk/core-agentlogsresponse-logs.html): Home > @medplum/core > AgentLogsResponse > logs (8 words) - [core.atom.tostring | Medplum](/content/docs/sdk/core-atom-tostring.html): Home > @medplum/core > Atom > toString (10 words) - [core.backgroundjobcontext.project | Medplum](/content/docs/sdk/core-backgroundjobcontext-project.html): Home > @medplum/core > BackgroundJobContext > project (7 words) - [core.agentchannelstats | Medplum](/content/docs/sdk/core-agentchannelstats.html): Home > @medplum/core > AgentChannelStats (15 words) - [Appointment $cancel | Medplum](/content/docs/scheduling/appointment-cancel/index.html): The $cancel operation is currently in beta. (369 words) - [Order Sets | Medplum](/content/docs/integration/scriptsure/order-sets/index.html): Order sets allow you to embed a pre-configured prescribing widget for a group of medications defined in a ScriptSure orderset. The orderset can be mapped to a Medplum PlanDefinition resource or referenced directly by its ScriptSure ID. (570 words) - [core.agentconnectrequest | Medplum](/content/docs/sdk/core-agentconnectrequest.html): Home > @medplum/core > AgentConnectRequest (19 words) - [Intake Questionnaires: Design and Extraction | Medplum](/content/docs/intake/intake-questionnaires/index.html): An intake questionnaire is different from a typical clinical form (like a PHQ-9 or wound assessment) because a single response fans out into many different FHIR resource types — Patient demographics, allergies, medications, conditions, insurance, consents, and more. This means the Questionnaire structure needs to be designed with extraction in mind: the way you organize items and name linkIds directly determines how reliably the response can be transformed into structured data. (1,416 words) - [core.atomcontext.variables | Medplum](/content/docs/sdk/core-atomcontext-variables.html): Home > @medplum/core > AtomContext > variables (8 words) - [core.arithmeticoperatoratom.impl | Medplum](/content/docs/sdk/core-arithmeticoperatoratom-impl.html): Home > @medplum/core > ArithmeticOperatorAtom > impl (15 words) - [Mantine 6.x to 7.x | Medplum](/content/docs/react/mantine-6x-to-7x/index.html): Mantine 7.0 is a major release that introduces breaking changes. This guide will help you to migrate your application from Mantine 6.x to 7.x. (346 words) - [core.addressformatoptions.use | Medplum](/content/docs/sdk/core-addressformatoptions-use.html): Home > @medplum/core > AddressFormatOptions > use (7 words) - [core.addprofiletoresource | Medplum](/content/docs/sdk/core-addprofiletoresource.html): Home > @medplum/core > addProfileToResource (51 words) - [core.addressformatoptions.lineseparator | Medplum](/content/docs/sdk/core-addressformatoptions-lineseparator.html): Home > @medplum/core > AddressFormatOptions > lineSeparator (7 words) - [Upload and Use Questionnaires | Medplum](/content/docs/questionnaires/basic-tutorial/index.html): This tutorial will walk through how to create a Questionnaire and generate a QuestionnaireResponse using the Medplum console app. The Questionnaire and QuestionnaireResponse resources are very common in implementations and are used to drive patient-facing and provider-facing experiences. (368 words) - [Patient Profile | Medplum](/content/docs/provider/patient-profile/index.html): The Patient Profile section in the Medplum Provider app is your central hub for managing all patient-related information. This section covers how to register new patients, edit existing profiles, and maintain the Patient Summary sidebar for quick access to key information. (549 words) - [core.agentconnectrequest.agentid | Medplum](/content/docs/sdk/core-agentconnectrequest-agentid.html): Home > @medplum/core > AgentConnectRequest > agentId (7 words) - [Medplum Provider | Medplum](/content/docs/provider/index.html): The Medplum Provider is a user-facing web application for clinical users and operations teams. In this section, you can learn about different features of the Provider App and the workflows they enable. (208 words) - [core.addressformatoptions.all | Medplum](/content/docs/sdk/core-addressformatoptions-all.html): Home > @medplum/core > AddressFormatOptions > all (8 words) - [core.addpharmacyresponse.message | Medplum](/content/docs/sdk/core-addpharmacyresponse-message.html): Home > @medplum/core > AddPharmacyResponse > message (8 words) - [core.addpharmacyresponse.success | Medplum](/content/docs/sdk/core-addpharmacyresponse-success.html): Home > @medplum/core > AddPharmacyResponse > success (8 words) - [core.addpharmacyresponse | Medplum](/content/docs/sdk/core-addpharmacyresponse.html): Home > @medplum/core > AddPharmacyResponse (30 words) - [core.addfavoriteparams.pharmacy | Medplum](/content/docs/sdk/core-addfavoriteparams-pharmacy.html): Home > @medplum/core > AddFavoriteParams > pharmacy (13 words) - [core.addoperation | Medplum](/content/docs/sdk/core-addoperation.html): Home > @medplum/core > AddOperation (20 words) - [core.addpharmacyresponse.organization | Medplum](/content/docs/sdk/core-addpharmacyresponse-organization.html): Home > @medplum/core > AddPharmacyResponse > organization (6 words) - [Setup | Medplum](/content/docs/integration/twilio-sms/setup/index.html): Step 1 — Install the integration (299 words) - [Profiles | Medplum](/content/docs/fhir-datastore/profiles/index.html): FHIR provides a broad variety of resources types to cover as many different types of healthcare data as possible, favoring generality over specificity. For example, the Observation resource type is used to record many different kinds of data: a patient's smoking status might be recorded using the valueCodeableConcept field, while the measurement data for blood pressure would exist as two separate entries under component.valueQuantity. (1,531 words) - [Sync Resources from Health Gorilla | Medplum](/content/docs/integration/health-gorilla/sync-resources-from-health-gorilla/index.html): This guide describes the sync-resources-from-health-gorilla bot, which fetches resources from Health Gorilla over a date range and synchronizes them into your Medplum project. (778 words) - [core.addoperation.value | Medplum](/content/docs/sdk/core-addoperation-value.html): Home > @medplum/core > AddOperation > value (8 words) - [core.addfavoriteparams.organization | Medplum](/content/docs/sdk/core-addfavoriteparams-organization.html): Home > @medplum/core > AddFavoriteParams > organization (19 words) - [core.addoperation.op | Medplum](/content/docs/sdk/core-addoperation-op.html): Home > @medplum/core > AddOperation > op (13 words) - [Observation Reference Ranges | Medplum](/content/docs/careplans/reference-ranges/index.html): In on our previous guide about creating diagnostic services catalog, we described the importance of the ObservationDefinition resource for storing metadata about the Observations produced by the test. This metadata is not just for ensuring data correctness, but also a key component in assisting providers with data interpretation. (1,872 words) - [core.addoperation.path | Medplum](/content/docs/sdk/core-addoperation-path.html): Home > @medplum/core > AddOperation > path (7 words) - [core.addfavoriteparams.setasprimary | Medplum](/content/docs/sdk/core-addfavoriteparams-setasprimary.html): Home > @medplum/core > AddFavoriteParams > setAsPrimary (7 words) - [core.addfavoriteparams | Medplum](/content/docs/sdk/core-addfavoriteparams.html): Home > @medplum/core > AddFavoriteParams (38 words) - [Questionnaires & Assessments | Medplum](/content/docs/questionnaires/index.html): Creating, updating and embedding FHIR Questionnaires for both patients and practitioners is a common use-case for Medplum. (233 words) - [Adding Practitioners & Data | Medplum](/content/docs/provider/getting-started/index.html): This section covers how to add practitioners and import existing data through the Medplum App (app.medplum.com). (274 words) - [External Messaging Integration Patterns | Medplum](/content/docs/communications/external-messaging-integration-patterns/index.html): These patterns show how to bridge Medplum messaging to external channels (SMS, email, push notifications) using Bots and on-demand $execute. For in-platform automations (Tasks, reminders, scheduling), see Messaging Automations. (2,020 words) - [Merging | Medplum](/content/docs/fhir-datastore/patient-deduplication/merging/index.html): merge-rules */} (2,035 words) - [core.addfavoriteparams.patientid | Medplum](/content/docs/sdk/core-addfavoriteparams-patientid.html): Home > @medplum/core > AddFavoriteParams > patientId (7 words) - [Sync a Patient | Medplum](/content/docs/integration/scriptsure/sync-patient/index.html): Bot: scriptsure-patient-sync-bot (444 words) - [Tree Shaking | Medplum](/content/docs/react/tree-shaking/index.html): Tree shaking, also known as dead code elimination, is a technique to keep JavaScript bundle sizes as small as possible. (184 words) - [Working with FHIR Data | Medplum](/content/docs/fhir-datastore/working-with-fhir/index.html): Now that we have gone through all CRUD operations, we can put them together to effectively work with FHIR data. This guide will go through a common healthcare workflow, creating an order for lab tests (a.k.a. ServiceRequest in FHIR) for patients and when the lab test is complete, creating results (a.k.a. Observation and DiagnosticReport in FHIR) that correspond to the original ServiceRequest. (1,243 words) - [Insurance Eligibility Checks | Medplum](/content/docs/billing/insurance-eligibility-checks/index.html): Insurance eligibility checks determine whether a patient's insurance is active, in-network, and has applicable benefits. They ensure that the provider will ultimately get compensated by the patient's insurer for a specific product or service. (1,858 words) - [Account Setup | Medplum](/content/docs/integration/scriptsure/account-setup/index.html): This guide walks through completing your ScriptSure account setup after Medplum has provisioned your organization. (430 words) - [Orders and Results | Medplum](/content/docs/integration/hl7-interfacing/orders-and-results/index.html): A common use case for HL7 is to place orders for diagnostics (labs and imaging commonly), and receive diagnostic results. There are two common message types, the ORM (order entry) and ORU (observation result). (468 words) - [Receiving SMS | Medplum](/content/docs/integration/twilio-sms/receiving-sms/index.html): When a patient sends a message to a registered Twilio number, the integration creates a Communication resource automatically. No application code is required. (196 words) - [MedplumClient Lifecycle Events | Medplum](/content/docs/react/lifecycle-events/index.html): When authenticating to Medplum via MedplumClient, there are few things to consider in terms of the MedplumClient authentication lifecycle and how you should structure your app around it -- (375 words) - [core.accesspolicysupportsinteraction | Medplum](/content/docs/sdk/core-accesspolicysupportsinteraction.html): Home > @medplum/core > accessPolicySupportsInteraction (89 words) - [HL7 Interfacing | Medplum](/content/docs/integration/hl7-interfacing/index.html): Medplum Bots enables highly customizable HL7 interfacing engine that can be used as an alternative to Mirth or Corepoint. Medplum allows developers to produce and consume HL7 feeds from legacy healthcare applications, such as EHRs, LIS, RIS/PACS, billing systems and more. (636 words) - [core.ackcode | Medplum](/content/docs/sdk/core-ackcode.html): Home > @medplum/core > AckCode (26 words) - [core.accesspolicyinteraction | Medplum](/content/docs/sdk/core-accesspolicyinteraction.html): Home > @medplum/core > AccessPolicyInteraction (43 words) - [Sequencing Your Migration | Medplum](/content/docs/migration/migration-sequence/index.html): [resources]: /docs/fhir-basics#storing-data-resources (188 words) - [Schedule | Medplum](/content/docs/provider/schedule/index.html): Effective schedule management is crucial for optimizing patient care delivery and clinic operations. The Medplum Provider app provides comprehensive scheduling tools to manage appointments, coordinate care, and maintain provider availability. This section covers the essential scheduling functions. (312 words) - [core | Medplum](/content/docs/sdk/core/index.html): Home > @medplum/core (9,499 words) - [core.accepted | Medplum](/content/docs/sdk/core-accepted.html): Home > @medplum/core > accepted (20 words) - [eFax Integration | Medplum](/content/docs/integration/efax/index.html): Medplum provides a first-party integration with eFax Corporate to send and receive faxes directly from your healthcare application. Faxes are stored as FHIR Communication resources, enabling seamless integration with your clinical workflows. (873 words) - [Search Architecture | Medplum](/content/docs/contributing/search-architecture/index.html): This page documents internal Medplum implementation details, and refers to point-in-time code snapshots that may be (1,429 words) - [Planning your Migration | Medplum](/content/docs/migration/migration-planning/index.html): The key to success for any data migration is planning. It is critical to know the data, know the systems, and communication with all stakeholders. The planning process begins before you write a single line of code. (290 words) - [index | Medplum](/content/docs/sdk/index.html): Home (6 words) - [Twilio SMS Integration | Medplum](/content/docs/integration/twilio-sms/index.html): Medplum provides an integration with Twilio to send and receive SMS messages directly from your healthcare application. Messages are stored as FHIR Communication resources, enabling seamless integration with your clinical workflows. (212 words) - [Creating Your First Thread | Medplum](/content/docs/communications/creating-your-first-thread/index.html): This walkthrough creates a thread through the FHIR API using MedplumClient. That matches how a real app (or Bot) writes messages. The Medplum App is useful as an inspector: confirm resources, references, and history—not as the primary authoring experience you ship to users. (1,281 words) - [Mutations | Medplum](/content/docs/graphql/mutations/index.html): GraphQL mutations are operations that allow the client to create, update, or delete data on the server. Unlike queries, which are read-only operations and can be executed in parallel, mutations are write operations. For more information about GraphQL mutations, refer to the GraphQL documentation. (944 words) - [Defining Availability | Medplum](/content/docs/scheduling/defining-availability/index.html): Medplum Scheduling APIs are currently in beta. (7,805 words) - [Medications | Medplum](/content/docs/medications/index.html): The E-Prescribe Decision Guide walks through requirements questions and FHIR modeling decisions for e-prescribing — use it alongside these docs. (142 words) - [Pharmacy Search | Medplum](/content/docs/integration/scriptsure/pharmacy-search/index.html): React hook: useScriptSurePharmacySearch (245 words) - [Migrating to Medplum | Medplum](/content/docs/migration/index.html): Consider the following common scenario: (97 words) - [Intake Data Model | Medplum](/content/docs/intake/intake-data-model/index.html): A patient intake form captures a wide range of information in a single interaction — demographics, insurance, medical history, medications, allergies, family history, and consent. In FHIR, this information fans out into many discrete resource types. This page maps out that resource graph, explains how the resources relate to each other, and identifies the US Core profiles that apply. (891 words) - [User Management | Medplum](/content/docs/integration/health-gorilla/user-management/index.html): This guide describes how to sync practitioners and patients between Medplum and Health Gorilla. (581 words) - [Stedi Integration | Medplum](/content/docs/integration/stedi/index.html): The RCM & Billing Decision Guide walks through requirements questions and FHIR modeling decisions for billing — charge capture, eligibility, claims, and remittance — use it alongside these docs. (134 words) - [Drug Interaction Check | Medplum](/content/docs/integration/scriptsure/drug-interaction/index.html): Bot: scriptsure-drug-interaction-bot (269 words) - [Representing Asynchronous Encounters | Medplum](/content/docs/communications/async-encounters/index.html): Intro (500 words) - [Intro | Medplum](/content/docs/cli/index.html): The Medplum CLI (Command Line Interface) is a set of command line tools to quickly deploy Medplum web applications and Medplum bots. (1,197 words) - [HealthGorilla Integration Changelog | Medplum](/content/docs/integration/health-gorilla/hg-changelog/index.html): This page tracks updates, improvements, and changes to the HealthGorilla integration in Medplum. (668 words) - [Understanding USCDI Data Classes | Medplum](/content/docs/fhir-datastore/understanding-uscdi-dataclasses/index.html): The United States Core Data for Interoperability (USCDI) is a standardized set of health data classes and constituent data elements for nationwide, interoperable health information exchange. (598 words) - [Longitudinal Patient Case Tracking | Medplum](/content/docs/careplans/longitudinal-patient-case-tracking/index.html): Many clinical scenarios span multiple visits over weeks, months, or years. A patient managing type 2 diabetes, for example, will have quarterly check-ups, lab orders, specialist referrals, and lifestyle interventions that all belong to the same ongoing case. A single Encounter captures one visit, but it cannot represent the full arc of care. (1,317 words) - [Bots in Production | Medplum](/content/docs/bots/bots-in-production/index.html): Editing bots in the web editor is good for getting started quickly, but as Bots become more important you will want to manage them as part of your regular software development lifecycle. This means: (1,689 words) - [Getting Started with DoseSpot | Medplum](/content/docs/integration/dosespot/getting-started/index.html): This guide explains how to get the DoseSpot eRx interface iframed into Medplum and sync the relevant resources between Medplum and DoseSpot. It is all integrated into the Provider App already, but these instructions will show you how to use the hooks and bots in your own application. (582 words) - [ScriptSure | Medplum](/content/docs/integration/scriptsure/index.html): The E-Prescribe Decision Guide walks through the integration and enrollment decisions behind an e-prescribing build — iframe vs. integrated UI, controlled substances, and prescriber enrollment — use it alongside these docs. (243 words) - [DICOM Data Model | Medplum](/content/docs/dicom/data-model/index.html): DICOM organizes imaging into a three-level hierarchy — study, series, instance — and (720 words) - [Log Streaming | Medplum](/content/docs/integration/log-streaming/index.html): These instructions primarily apply to self-hosted users. To set up log streaming on the Medplum Hosted instance, please reach out to info@medplum.com (244 words) - [Messaging Data Model | Medplum](/content/docs/communications/messaging-data-model/index.html): In a healthcare context, messages are sent all the time and can include many scenarios (patient to physician, physician to physician, and more), so ensuring they are well organized is important. This guide explains how to model and organize threads in Medplum. (1,397 words) - [Running Bots on Fission | Medplum](/content/docs/bots/running-bots-on-fission/index.html): Medplum Bots provide powerful automation capabilities within your Medplum environment. While Medplum offers a built-in execution environment for bots, this page details how to deploy and manage your Medplum Bots using Fission, an open-source, Kubernetes-native serverless framework. This approach can be beneficial for organizations seeking advanced scalability, custom runtime environments, or deeper integration with existing Kubernetes infrastructure. (1,070 words) - [Prescribing iFrame | Medplum](/content/docs/integration/scriptsure/iframe/index.html): ScriptSure offers a fully hosted prescribing UI that can be embedded directly in your application as an authenticated iFrame. This is an alternative to building a custom prescribing flow using the ScriptSure APIs–rather than integrating drug search, order creation, and pharmacy management individually, the iFrame provides all of that in a single pre-built interface. It handles EULA acceptance, identity proofing, DDI/allergy checks, and prescription submission out of the box. (215 words) - [SMART Health Links | Medplum](/content/docs/intake/smart-health-links/index.html): This guide describes a practical workflow for testing SMART Health Links (SHLs) between independent healthcare applications. (707 words) - [Admit, Discharge, Transfer (ADT) | Medplum](/content/docs/integration/hl7-interfacing/adt/index.html): ADT stands for "Admit, Discharge, Transfer." It is a type of HL7 message used in electronic health records systems to communicate changes in a patient's demographic or visit status. This includes registration, admission, discharge, and transfer information about a patient. (330 words) - [Eligibility Check | Medplum](/content/docs/integration/candid/eligibility-check/index.html): This guide explains how to verify a patient's insurance coverage before an encounter using the Candid Health pre-encounter eligibility API. (545 words) - [Electronic Prior Auth | Medplum](/content/docs/integration/electronic-prior-auth/index.html): Medplum CMS-0057-F Electronic Prior Auth is currently in alpha. (626 words) - [Intake & Registration Decision Guide | Medplum](/content/docs/decision-guides/intake/index.html): Companion to the Intake & Registration docs. (1,726 words) - [Referrals Decision Guide | Medplum](/content/docs/decision-guides/referrals/index.html): Companion to the Referral Management docs. (1,626 words) - [DICOM with the Medplum Agent | Medplum](/content/docs/dicom/agent-dimse/index.html): Imaging equipment does not speak DICOMweb. Modalities, workstations, and legacy PACS speak DIMSE — (977 words) - [MedicationAdministration | Medplum](/content/docs/api/fhir/resources/medicationadministration/index.html): Describes the event of a patient consuming or otherwise being administered a medication. This may be as simple as swallowing a tablet or it may be a long running infusion. Related resources tie this event to the authorizing prescription, and the specific encounter between patient and health care practitioner. (2,965 words) - [ServiceRequest | Medplum](/content/docs/api/fhir/resources/servicerequest/index.html): A record of a request for service such as diagnostic investigations, treatments, or operations to be performed. (2,300 words) - [Updating Data | Medplum](/content/docs/fhir-datastore/updating-data/index.html): Medplum offers three FHIR operations that can be used to update data: (883 words) - [Bot Basics | Medplum](/content/docs/bots/bot-basics/index.html): Bots are an advanced Medplum feature that enable complex workflows. A Medplum Bot is a snippet of JavaScript code that can run on any resource change (create or update). This JavaScript code has access to a Medplum client , which itself can invoke FHIR operations. (1,709 words) - [E-Prescribe Decision Guide | Medplum](/content/docs/decision-guides/e-prescribe/index.html): Companion to the E-Prescribe (eRx) docs. (1,155 words) - [Clinic Favorite Medications | Medplum](/content/docs/integration/dosespot/clinic-favorite-medications/index.html): The Medplum-DoseSpot integration allows you to configure clinic favorite medications which can significantly reduce the number of clicks required for clinicians to prescribe common medications. This allows your organization to: (315 words) - [DoseSpot | Medplum](/content/docs/integration/dosespot/index.html): The E-Prescribe Decision Guide walks through the integration and enrollment decisions behind an e-prescribing build — iframe vs. integrated UI, controlled substances, and prescriber enrollment — use it alongside these docs. (796 words) - [Post Intake Automation | Medplum](/content/docs/intake/post-intake-automation/index.html): The patient submitted their intake form — now what? This page covers the patterns for triggering intake processing and the workflows that follow once intake data has been ingested into FHIR resources. (796 words) - [Read Receipts and Message Status | Medplum](/content/docs/communications/read-receipts-and-message-status/index.html): How you track sent, received, and read for messages depends on two things: whether a message can have more than one recipient (group threads), and whether you need to search for unread messages via the API. Use the decision guide below to choose the right model. (885 words) - [Thread Lifecycle, Participants, and Access Control | Medplum](/content/docs/communications/thread-lifecycle-participants-access-control/index.html): This guide explains how thread header Communication.status models open versus closed threads, how to manage participants on the header with recipient, and how FHIR access policies align with who should see a thread. (1,095 words) - [Visit Templates and the SOAP Approach | Medplum](/content/docs/charting/visit-templates/index.html): Most clinical products still organize encounter documentation around some variant of SOAP – Subjective, Objective, Assessment, Plan – even when the screen does not label the sections that way. Visit templates are how Medplum ties that workflow to FHIR: instead of a single undifferentiated note, you instantiate a PlanDefinition per visit type so clinicians get the right questionnaires and order tasks when the encounter opens (Care Templates in Medplum Provider are this concept in the UI). (1,184 words) - [Consent and Signatures | Medplum](/content/docs/consent/index.html): Medplum captures consents and signatures as structured, versioned FHIR data rather than as opaque PDFs. The Consent resource is the primitive: it records what a patient agreed to, when they agreed, which policy governed the agreement, and — because every write is versioned — who recorded it and what changed afterward. (1,124 words) - [Deleting Data | Medplum](/content/docs/fhir-datastore/deleting-data/index.html): The management of healthcare information relies heavily on the effective and secure handling of data. A critical aspect of FHIR data store management is the delete operation, which ensures the removal of outdated or erroneous records as necessary. This article will provide an overview of the deleting data in Medplum, including the differences between "soft delete" and "hard delete" methods. Understanding these distinctions is essential for making informed decisions when dealing with sensitive healthcare data. (645 words) - [Specimen | Medplum](/content/docs/api/fhir/resources/specimen/index.html): A sample to be used for analysis. (2,952 words) - [C-CDA | Medplum](/content/docs/integration/c-cda/index.html): Medplum provides support for C-CDA (Consolidated Clinical Document Architecture) handling in accordance with the ONC Certification criteria (g)(7), (g)(9) and (b)(1) as well as developer utilities for working with C-CDA documents in the context of FHIR. (506 words) - [Unit Testing Bots | Medplum](/content/docs/bots/unit-testing-bots/index.html): Unit testing your Bot code is crucial to ensuring accurate data and workflows. This guide will go over the most common unit testing patterns. (1,449 words) - [SupplyRequest | Medplum](/content/docs/api/fhir/resources/supplyrequest/index.html): A record of a request for a medication, substance or device used in the healthcare setting. (1,909 words) - [Access Control Decision Guide | Medplum](/content/docs/decision-guides/access-control/index.html): Companion to the Authorization and Access Control docs. (913 words) - [Connection API | Medplum](/content/docs/graphql/connections/index.html): Using the normal "List" search (i.e., "PatientList") is the most common way to search for resources. However, the FHIR GraphQL specification also supports the Connection API, which is a more complex way to search for resources. (268 words) - [LOINC Codes | Medplum](/content/docs/careplans/loinc/index.html): LOINC (Logical Observation Identifiers Names and Codes) was established with the intention of defining a universal standard for identifying clinical data in electronic reports. The overall scope of LOINC is anything you can test, measure, or observe about a patient. (1,351 words) - [Representing Patient Insurance Coverage | Medplum](/content/docs/billing/patient-insurance/index.html): Introduction (1,272 words) - [Connecting to External FHIR Servers | Medplum](/content/docs/cli/external-fhir-servers/index.html): When building an application, you many need to query or write data to an external FHIR server as part of your application's workflow. For example: (927 words) - [CDS Hooks | Medplum](/content/docs/integration/cds-hooks/index.html): CDS Hooks is a standard for surfacing clinical decision support at key points in a clinician's EHR workflow. The EHR fires a hook such as `patient-view` or `order-sign`, sends context to a CDS service, and receives cards with guidance, warnings, or suggested actions. (363 words) - [Clinical Protocols | Medplum](/content/docs/careplans/protocols/index.html): In FHIR, care workflows and clinical protocols are primarily modeled using the PlanDefinition resource. (956 words) - [VerificationResult | Medplum](/content/docs/api/fhir/resources/verificationresult/index.html): Describes validation requirements, source(s), status and dates for one or more elements. (1,019 words) - [FHIR Resource Examples | Medplum](/content/docs/careplans/referrals/fhir-resource-examples/index.html): ServiceRequest Example (709 words) - [Matching | Medplum](/content/docs/fhir-datastore/patient-deduplication/matching/index.html): matching-rules */} (802 words) - [Terminology Architecture | Medplum](/content/docs/contributing/terminology-architecture/index.html): This page documents internal Medplum implementation details, and refers to point-in-time code snapshots that may be (1,003 words) - [DICOMweb API | Medplum](/content/docs/dicom/dicomweb-api/index.html): Medplum serves DICOMweb under /dicomweb on the same (694 words) - [Resource History | Medplum](/content/docs/fhir-datastore/resource-history/index.html): The Medplum backend stores every version of a resource, allowing you to easily track changes over time. Resource history can be viewed in the Medplum App or by accessing the /_history endpoint. (519 words) - [SearchParameter | Medplum](/content/docs/api/fhir/resources/searchparameter/index.html): A search parameter that defines a named search item that can be used to search/filter on a resource. (2,923 words) - [SubstancePolymer | Medplum](/content/docs/api/fhir/resources/substancepolymer/index.html): Todo. (2,975 words) - [Binary Data | Medplum](/content/docs/fhir-datastore/binary-data/index.html): Managing, storing, and retrieving binary files is a fundamental requirement in modern healthcare applications. Medplum, an open-source, API-first healthcare technology platform, provides a structured approach to this. This article dives into how to upload binary files to Medplum using the FHIR Binary resource type, detailing the process and Medplum's specific optimizations. (852 words) - [External Files and Document References | Medplum](/content/docs/fhir-datastore/external-documents/index.html): While the most valuable way of storing healthcare information is in a structured FHIR representation, healthcare apps often need to store and index documents from external systems. For example, patients may submit medical records from other providers in the form of PDF documents. (409 words) - [Referral Management | Medplum](/content/docs/careplans/referrals/index.html): The Referrals Decision Guide walks through requirements questions and FHIR modeling decisions for referrals — use it alongside these docs. (471 words) - [Chart Data Model | Medplum](/content/docs/charting/chart-data-model/index.html): A charting UI reads patient-level data that persists across visits and encounter-level data created during each visit. This page is a reference: the first half covers longitudinal patient context (summary, demographics, devices), the second covers encounter-time resources (Observations, Conditions, Allergies, external documents). Each major resource has its own section. For visit orchestration and the SOAP-aligned template pattern, see Visit Templates and the SOAP Approach. (546 words) - [Ingestion | Medplum](/content/docs/fhir-datastore/patient-deduplication/ingestion/index.html): Batch vs. Incremental Pipelines (422 words) - [Searching and Querying Threads | Medplum](/content/docs/communications/searching-and-querying-threads/index.html): How you populate sender and recipient on the thread header affects these queries. For recommended modeling (including listing the thread creator in recipient), see Building and Structuring Threads. (506 words) - [Message Attachments | Medplum](/content/docs/communications/sending-messages-and-attachments/index.html): Communication.payload supports three content types. You can combine multiple entries in a single message. (577 words) - [OHIF Viewer | Medplum](/content/docs/dicom/ohif-viewer/index.html): OHIF is an open source, zero-footprint DICOM viewer that reads studies over (300 words) - [Message Editing and Drafts | Medplum](/content/docs/communications/message-editing-and-drafts/index.html): This page covers two workflows: correcting a message that has already been sent, and saving draft messages before sending. The editing section presents both a compliance-focused retract-and-correct pattern and a simpler in-place update alternative. The drafts section covers browser-only and cross-device persistence strategies. (951 words) - [Candid Health Integration | Medplum](/content/docs/integration/candid/index.html): The RCM & Billing Decision Guide walks through requirements questions and FHIR modeling decisions for billing — charge capture, eligibility, claims, and remittance — use it alongside these docs. (110 words) - [Intake & Registration | Medplum](/content/docs/intake/index.html): The Intake & Registration Decision Guide walks through requirements questions and FHIR modeling decisions for intake — use it alongside these docs. (173 words) - [FHIRcast | Medplum](/content/docs/fhircast/index.html): Medplum supports FHIRcast STU3. (494 words) - [DICOM with the Medplum CLI | Medplum](/content/docs/dicom/cli/index.html): The Medplum CLI can store a DICOM file through STOW-RS directly, which makes it the (688 words) - [FHIRcast with .NET client | Medplum](/content/docs/fhircast/dotnet-client/index.html): This is a guide for using the official FHIRcast .NET client with the Medplum server. (199 words) - [Referral Transmission & Tracking | Medplum](/content/docs/careplans/referrals/transmition-and-tracking/index.html): Transmitting Referrals (686 words) - [Architecture Overview | Medplum](/content/docs/fhir-datastore/patient-deduplication/architecture-overview/index.html): Glossary (484 words) - [Defining your Diagnostic Catalog | Medplum](/content/docs/careplans/diagnostic-catalog/index.html): A diagnostic catalog contains all the pertinent information about the diagnostic services you provide, including your analytes, reference ranges, panels, specimen requirements, and laboratory procedures. (646 words) - [Server Config | Medplum](/content/docs/self-hosting/server-config/index.html): When running Medplum server on a local developer machine, Medplum server typically loads config settings from a JSON config file. By default, it loads config settings from medplum.config.json. (3,350 words) - [HTI-4 & CMS-0057-F | Medplum](/content/docs/compliance/hti-4/index.html): The "Health Data, Technology, and Interoperability" (HTI-4) rule is a new ONC regulation finalized on July 31, 2025, becoming effective October 1, 2025. This rule modernizes the entire prescribing workflow by mandating new technical certifications across all certified health IT systems, shifting key interoperability functions from optional features to mandatory requirements for certification. (556 words) - [Medplum $ai Operation | Medplum](/content/docs/ai/ai-operation/index.html): Medplum's $ai operation enables integration with large language models (LLMs) through a FHIR-compliant interface. This operation allows you to leverage AI capabilities for conversational interactions and FHIR function calling within your healthcare applications. (1,347 words) - [Contributing to Medplum | Medplum](/content/docs/contributing/index.html): Medplum is an open-source project, and we love both code and non-code contributions! People with any level of experience (589 words) - [Referral Creation & Capture | Medplum](/content/docs/careplans/referrals/creation-and-capture/index.html): referral-creation */} (712 words) - [Charting Decision Guide | Medplum](/content/docs/decision-guides/charting/index.html): Companion to the Charting docs (SOAP notes, diagnoses, vitals, allergies), plus Provider Visits, Structured Data Capture, PlanDefinition $apply, and QuestionnaireResponse $extract. (1,015 words) - [Run the Stack | Medplum](/content/docs/contributing/run-the-stack/index.html): Follow these instructions to get the complete Medplum stack running directly on your host machine. (606 words) - [ONC Certification | Medplum](/content/docs/compliance/onc/index.html): Medplum is ONC Certified. Below are certification resources and documentation. (455 words) - [ISO 9001 | Medplum](/content/docs/compliance/iso9001/index.html): ISO 9001 is a Quality Management System (QMS) standard. This page describes how the standard maps to Medplum's processes. You can read more about ISO 9001 on Wikipedia. The standard follows the plan-do-check-act (PCDA) methodology. (640 words) - [Patient Deduplication Architectures | Medplum](/content/docs/fhir-datastore/patient-deduplication/index.html): Deduplicating patient records from multiple sources is a nuanced workflow. We've put this guide together to go over the basics of merging patient records, and review some of the most important technical design considerations when building a patient deduplication pipeline. The pipeline described here is the basis of an Enterprise Master Patient Index (EMPI). (217 words) - [Creating Data | Medplum](/content/docs/fhir-datastore/creating-data/index.html): Data is created in FHIR by using the create operation, which is performed by sending a POST request to the server. (100 words) - [SubstanceNucleicAcid | Medplum](/content/docs/api/fhir/resources/substancenucleicacid/index.html): Nucleic acids are defined by three distinct elements: the base, sugar and linkage. Individual substance/moiety IDs will be created for each of these elements. The nucleotide sequence will be always entered in the 5’-3’ direction. (2,780 words) - [Good Manufacturing Practices | Medplum](/content/docs/compliance/gmp/index.html): Good Manufacturing Practices (GMP) are a set of guidelines, regulations, and quality management systems designed to ensure that products, particularly pharmaceuticals, medical devices, and food products, are consistently manufactured, controlled, and tested according to established quality standards. (453 words) - [Working with package.json | Medplum](/content/docs/contributing/package-json/index.html): The Medplum codebase uses NPM workspaces to manage approximately 50 packages in a single monorepo. This structure provides many benefits but can be confusing when it comes to dependency management. This guide explains best practices for working with dependencies in our monorepo. (599 words) - [Building on Medplum with AI Coding Assistants | Medplum](/content/docs/building-with-ai-coding-assistants/index.html): Agentic engineering (a.k.a. "vibe coding") means using an LLM or agent – Cursor, Claude, (960 words) - [Running AWS Lambda Bots with Localhost | Medplum](/content/docs/contributing/aws-lambda-bots-on-localhost/index.html): When developing for Medplum, you may want your local Medplum Server to trigger and execute AWS Lambda-based Bots. This setup allows you to test Lambda-specific behavior (like cold starts or resource limits) without deploying your entire server stack to the cloud. (351 words) - [Developer Certificate of Origin | Medplum](/content/docs/contributing/dco/index.html): At Medplum, we've enabled the Developer Certificate of Origin (DCO) for all contributions to our repositories. This means every commit to the Medplum codebase needs to be "signed off" by the author. We understand this might be a new process for some, and we're here to help you get started. (929 words) - [FHIR Datastore | Medplum](/content/docs/fhir-datastore/index.html): The Medplum FHIR Datastore supports all CRUD operations (creating, reading/searching, updating, and deleting) on FHIR resources. In addition it supports a large set of additional operations that can be used to validate and model data, execute bots, and more. If you are not familiar with FHIR, see the FHIR Basics docs. (129 words) - [Life Sciences | Medplum](/content/solutions/life-sciences/index.html): Highly customizable and integrated data management solution for clinical research and commercialization including: (1,433 words) - [Alpha & Beta Features | Medplum](/content/docs/compliance/alpha-beta/index.html): Some Medplum features are released before they reach general availability (GA). This page explains what the Alpha and Beta labels mean and what to expect when building on pre-GA features. (496 words) - [MFA Under the Hood: Routes & User Flows | Medplum](/content/docs/auth/how-mfa-works/index.html): This page is a deep dive into how Multi-Factor Authentication works in Medplum: the underlying HTTP routes and the user flows that combine them. It is intended for developers building their own MFA management UI — those who cannot use Medplum's SignInForm component or the Medplum App Security page and need to drive enrollment and challenge completion directly. (1,466 words) - [Designing Charting | Medplum](/content/docs/charting/designing-charting/index.html): Charting is one of the most important features of an EMR – and one of the hardest to get right. Clinicians have strong opinions shaped by training, specialty, and years in other systems. The surface experience varies enormously: dense structured forms in some products, narrative-first layouts in others. Underneath all of it, the record still has to support safe care and downstream data use. (381 words) - [StructureMap | Medplum](/content/docs/api/fhir/resources/structuremap/index.html): A Map of relationships between 2 structures that can be used to transform data. (2,534 words) - [HL7 to FHIR | Medplum](/content/docs/bots/hl7-into-fhir/index.html): HL7 interfaces are common in healthcare, and widely supported by legacy EHRs, RIS/PACS systems, lab machines and more. Medplum provides a HL7 Interfacing engine that supports consumption and production of HL7 feeds, and the Medplum Agent supports connecting to systems on-premises. (760 words) - [Token Exchange | Medplum](/content/docs/auth/token-exchange/index.html): Overview (1,203 words) - [Server Profiling | Medplum](/content/docs/contributing/server-profiling/index.html): Medplum is designed to be a critical component of system architecture. It is important that Medplum server is robust, performant, and scalable. Hand in hand with Load Testing, profiling the server is critical in understanding performance bottlenecks and scaling challenges. (414 words) - [CFR Part 11 Certification | Medplum](/content/docs/compliance/cfr11/index.html): This section is under active development. (487 words) - [Substance | Medplum](/content/docs/api/fhir/resources/substance/index.html): A homogeneous material with a definite composition. (1,903 words) - [Designing Your Workflows | Medplum](/content/docs/decision-guides/index.html): Decision guides are companion documents to the Medplum docs. Each one walks through the requirements questions and FHIR modeling decisions for a specific workflow area — who uses it, what data flows through it, how it integrates with other systems, and which Medplum primitives best fit each requirement. (467 words) - [Install on Azure | Medplum](/content/docs/self-hosting/install-on-azure/index.html): This document is intended to guide users through the deployment of Medplum on Azure using Terraform. It provides detailed instructions and configurations necessary to set up essential components such as a Virtual Network (Vnet), Azure Kubernetes Services (AKS) cluster, PostgreSQL database, Storage accounts, CDN, and Redis instances. The purpose is to ensure a smooth and efficient deployment process tailored to Medplum’s specific requirements, facilitating scalability, security, and high availability within their cloud environment. (1,747 words) - [Client Assertion (JWT Bearer) | Medplum](/content/docs/auth/client-assertion/index.html): Client Assertion is an alternative to the Client Credentials flow that authenticates the client using a signed JWT instead of a shared client secret. The client signs the JWT with a private key; Medplum verifies it against the public keys published at the client's JWKS URI. (895 words) - [SupplyDelivery | Medplum](/content/docs/api/fhir/resources/supplydelivery/index.html): Record of delivery of what is supplied. (780 words) - [Bot Code Organization and Build Setup | Medplum](/content/docs/bots/bot-code-organization/index.html): As your integration grows, you will likely end up with multiple bots that share common logic — API client setup, FHIR resource transforms, shared constants, and so on. Without a strategy, this leads to duplicated logic across bot files that become hard to maintain, quickly growing to thousands of lines. (834 words) - [Publishing NPM Packages | Medplum](/content/docs/contributing/publishing-npm-packages/index.html): This is the process we use to publish new versions of JavaScript NPM packages. (225 words) - [Local development setup | Medplum](/content/docs/contributing/local-dev-setup/index.html): Ready to get started developing Medplum on your local machine? Great! First, you'll need to set up your own copy of the (339 words) - [SubstanceReferenceInformation | Medplum](/content/docs/api/fhir/resources/substancereferenceinformation/index.html): Todo. (1,948 words) - [Measure | Medplum](/content/docs/api/fhir/resources/measure/index.html): The Measure resource provides the definition of a quality measure. (475 words) - [TerminologyCapabilities | Medplum](/content/docs/api/fhir/resources/terminologycapabilities/index.html): A TerminologyCapabilities resource documents a set of capabilities (behaviors) of a FHIR Terminology Server that may be used as a statement of actual server functionality or a statement of required or desired server implementation. (1,598 words) - [Compliance | Medplum](/content/docs/compliance/index.html): As an Medplum customer, you will benefit from the compliance built into the platform. With Medplum, you can improve your ability to meet compliance requirements with our tools and automations. (263 words) - [TestReport | Medplum](/content/docs/api/fhir/resources/testreport/index.html): A summary of information based on the results of executing a TestScript. (1,174 words) - [Upgrading Dependencies | Medplum](/content/docs/contributing/upgrading-dependencies/index.html): Medplum upgrades dependencies regularly to ensure we have the latest security patches and bug fixes. This document describes the process for upgrading dependencies. (208 words) - [Care Plans | Medplum](/content/docs/careplans/index.html): Care Plans are representations of protocols that patients are meant to follow. They exist in two modes: (382 words) - [Authorize endpoint | Medplum](/content/docs/api/oauth/authorize/index.html): The /oauth2/authorize endpoint signs in the user. (1,180 words) - [Testing | Medplum](/content/docs/contributing/testing/index.html): Medplum strongly believes in the importance of testing. (187 words) - [SubstanceSourceMaterial | Medplum](/content/docs/api/fhir/resources/substancesourcematerial/index.html): Source material shall capture information on the taxonomic and anatomical origins as well as the fraction of a material that can result in or can be modified to form a substance. This set of data elements shall be used to define polymer substances isolated from biological matrices. Taxonomic and anatomical origins shall be described using a controlled vocabulary as required. This information is captured for naturally derived polymers ( . starch) and structurally diverse substances. For Organisms belonging to the Kingdom Plantae the Substance level defines the fresh material of a single species or infraspecies, the Herbal Drug and the Herbal preparation. For Herbal preparations, the fraction information will be captured at the Substance information level and additional information for herbal extracts will be captured at the Specified Substance Group 1 information level. See for further explanation the Substance Class: Structurally Diverse and the herbal annex. (979 words) - [HITRUST Certification | Medplum](/content/docs/compliance/hitrust/index.html): Medplum has achieved HITRUST e1 certification for the Medplum Platform residing at Amazon Web Services (AWS). The HITRUST e1 Certification demonstrates that strong controls are in place to protect sensitive data and manage risk effectively, validated through independent third-party assessment under the HITRUST Assurance Program. (130 words) - [HIPAA Compliance | Medplum](/content/docs/compliance/hipaa/index.html): Medplum is HIPAA Compliant. Customers can request materials in this section to support their own business or compliance needs. (54 words) - [Invite User Endpoint | Medplum](/content/docs/api/project-admin/invite/index.html): POST /admin/projects/:projectId/invite (709 words) - [Mutual TLS (mTLS) | Medplum](/content/docs/auth/mtls/index.html): Mutual TLS (mTLS) is a client authentication mechanism built on top of standard TLS. In addition to the server presenting a certificate to the client (standard TLS), the client also presents an X.509 certificate to the server, which verifies it against a configured trust store. This provides strong, cryptographic proof of client identity without transmitting a shared secret. (792 words) - [Subscription | Medplum](/content/docs/api/fhir/resources/subscription/index.html): The subscription resource is used to define a push-based subscription from a server to another system. Once a subscription is registered with the server, the server checks every resource that is created or updated, and if the resource matches the given criteria, it sends a message on the defined "channel" so that another system can take an appropriate action. (1,793 words) - [SubstanceSpecification | Medplum](/content/docs/api/fhir/resources/substancespecification/index.html): The detailed description of a substance, typically at a level beyond what is used for prescribing. (681 words) - [Schedule | Medplum](/content/docs/api/fhir/resources/schedule/index.html): A container for slots of time that may be available for booking appointments. (1,240 words) - [GuidanceResponse | Medplum](/content/docs/api/fhir/resources/guidanceresponse/index.html): A guidance response is the formal response to a guidance request, including any output parameters returned by the evaluation, as well as the description of any proposed actions to be taken. (1,548 words) - [On-Behalf-Of | Medplum](/content/docs/auth/on-behalf-of/index.html): The Medplum API supports an "On-Behalf-Of" feature to enable a Customer Server Side App to act on behalf of a Medplum user. (588 words) - [CodeSystem $lookup | Medplum](/content/docs/api/fhir/operations/codesystem-lookup/index.html): The $lookup operation retrieves detailed information about a specific code from a code system. This is essential for applications that need to display human-readable descriptions, validate code properties, or understand the relationships and metadata associated with clinical terminology codes. (1,141 words) - [Slot | Medplum](/content/docs/api/fhir/resources/slot/index.html): A slot of time on a schedule that may be available for booking appointments. (1,135 words) - [Users | Medplum](/content/docs/api/scim/users/index.html): Medplum supports the standard SCIM Users API endpoints. (329 words) - [MedicinalProductIndication | Medplum](/content/docs/api/fhir/resources/medicinalproductindication/index.html): Indication for the Medicinal Product. (673 words) - [RiskEvidenceSynthesis | Medplum](/content/docs/api/fhir/resources/riskevidencesynthesis/index.html): The RiskEvidenceSynthesis resource describes the likelihood of an outcome in a population plus exposure state where the risk estimate is derived from a combination of research studies. (613 words) - [ClinicalImpression | Medplum](/content/docs/api/fhir/resources/clinicalimpression/index.html): A record of a clinical assessment performed to determine what problem(s) may affect the patient and before planning the treatments or management strategies that are best to manage a patient's condition. Assessments are often 1:1 with a clinical consultation / encounter, but this varies greatly depending on the clinical workflow. This resource is called "ClinicalImpression" rather than "ClinicalAssessment" to avoid confusion with the recording of assessment tools such as Apgar score. (2,531 words) - [Agent Features | Medplum](/content/docs/agent/features/index.html): Each feature that the Agent supports, such as the Agent/$push operation, Agent/$status, Agent/$reload-config, etc. all require minimum versions of both Medplum Server and Medplum Agent in order to work. The matrix of feature, Medplum Server version, and Medplum Agent version looks like this: (2,004 words) - [Bot for QuestionnaireResponse | Medplum](/content/docs/bots/bot-for-questionnaire-response/index.html): Bots are an advanced Medplum feature that enable complex workflows. (1,812 words) - [The Apps Tab | Medplum](/content/docs/app/apps-tab/index.html): The Medplum App allows for easy integration of workflows and third-party applications using the Apps tab. It is important to reiterate that the Medplum App is targeted towards developers and the Apps tab is primarily a tool to help with developer automation. (353 words) - [Account | Medplum](/content/docs/api/fhir/resources/account/index.html): A financial tool for tracking value accrued for a particular purpose. In the healthcare field, used to track charges for a patient, cost centers, etc. (1,803 words) - [MedicationDispense | Medplum](/content/docs/api/fhir/resources/medicationdispense/index.html): Indicates that a medication product is to be or has been dispensed for a named person/patient. This includes a description of the medication product (supply) provided and the instructions for administering the medication. The medication dispense is the result of a pharmacy system responding to a medication order. (2,490 words) - [Domain-level Identity Providers | Medplum](/content/docs/auth/domain-level-identity-providers/index.html): A Domain-level Identity Provider (DL-IDP) is a server-level configuration that sets up an external identity provider for all users from a given domain. This identity provider will be used for all Medplum applications the user logs into, including the Medplum App. Domain-level providers are primarily used to ensure that all practitioners access Medplum data via your corporate identity solution. (537 words) - [Authentication | Medplum](/content/docs/auth/index.html): This page helps you choose the correct authentication method for your application, whether it's a browser, a server, or a device. The primary goal is to guide you to the right documentation page based on your use case. (524 words) - [Task | Medplum](/content/docs/api/fhir/resources/task/index.html): A task to be performed. (993 words) - [Bulk FHIR API | Medplum](/content/docs/api/fhir/operations/bulk-fhir/index.html): Medplum supports the Bulk FHIR API 2.0.0. The Bulk FHIR API uses Backend Services Authorization. (603 words) - [Google Authentication | Medplum](/content/docs/auth/google-auth/index.html): Medplum supports using Google Authentication as an external identity provider, as well as other external identity providers using the OAuth2 protocol. Google Authentication allows users to log in to your application using their Google profile. (553 words) - [Introduction | Medplum](/content/docs/app/app-introduction/index.html): The Medplum App is a user-facing web application available at https://app.medplum.com/ and is targeted towards developers and project administrators. This administrative app is developed from the Medplum React Components, meaning that many of these views and functionality can be embedded into your own custom apps. (613 words) - [Invite a user | Medplum](/content/docs/app/invite/index.html): This guide explains how to invite another user to your Medplum project. (487 words) - [Billing | Medplum](/content/docs/billing/index.html): The RCM & Billing Decision Guide walks through requirements questions and FHIR modeling decisions for billing — use it alongside these docs. (253 words) - [Acknowledgement Modes | Medplum](/content/docs/agent/acknowledgement-modes/index.html): HL7 Acknowledgement Modes define the handshaking protocol between systems exchanging messages over protocols like MLLP. The Medplum Agent supports both Original and Enhanced modes, allowing you to configure connections for optimal throughput and reliability. (1,212 words) - [Medplum Agent: Secure Bridge for Legacy Healthcare Systems | Medplum](/content/solutions/agent/index.html): Healthcare organizations need to integrate HL7, DICOM, and other legacy protocols that operate within closed networks—but maintaining site-to-site VPNs is complex and costly, and legacy integration engines may not be flexible and cloud-first in architecture. The Medplum Agent eliminates these issues while preserving security and compliance. (548 words) - [TriggerDefinition | Medplum](/content/docs/api/fhir/datatypes/triggerdefinition/index.html): Base StructureDefinition for TriggerDefinition Type: A description of a triggering event. Triggering events can be named events, data events, or periodic, as determined by the type element. (532 words) - [Bot Endpoint | Medplum](/content/docs/api/project-admin/bot/index.html): POST /admin/projects/:projectId/bot (133 words) - [SubstanceProtein | Medplum](/content/docs/api/fhir/resources/substanceprotein/index.html): A SubstanceProtein is defined as a single unit of a linear amino acid sequence, or a combination of subunits that are either covalently linked or have a defined invariant stoichiometric relationship. This includes all synthetic, recombinant and purified SubstanceProteins of defined sequence, whether the use is therapeutic or prophylactic. This set of elements will be used to describe albumins, coagulation factors, cytokines, growth factors, peptide/SubstanceProtein hormones, enzymes, toxins, toxoids, recombinant vaccines, and immunomodulators. (445 words) - [VisionPrescription | Medplum](/content/docs/api/fhir/resources/visionprescription/index.html): An authorization for the provision of glasses and/or contact lenses to a patient. (331 words) - [5 docs tagged with "intake" | Medplum](/content/docs/tags/intake/index.html) (246 words) - [Timing | Medplum](/content/docs/api/fhir/datatypes/timing/index.html): Base StructureDefinition for Timing Type: Specifies an event that may occur multiple times. Timing schedules are used to record when things are planned, expected or requested to occur. The most common usage is in dosage instructions for medications. They are also used when planning care of various kinds, and may be used for reporting the schedule to which past regular activities were carried out. (993 words) - [Resource $csv | Medplum](/content/docs/api/fhir/operations/csv/index.html): The $csv operation exports FHIR resources as a CSV (Comma-Separated Values) file, which is useful for exporting data for analysis in spreadsheet applications, reporting tools, or data pipelines. (387 words) - [Client Application Endpoint | Medplum](/content/docs/api/project-admin/client/index.html): POST /admin/projects/:projectId/client (155 words) - [Clinical Decision Support | Medplum](/content/docs/careplans/clinical-decision-support/index.html): Medplum enables building and delivering custom clinical decision support tools for a variety of applications. This guide focuses on the regulated ONC Criteria for Clinical Decision support which is criteria (a)(9) of the HTI criteria on predictive CDS. (661 words) - [SubstanceAmount | Medplum](/content/docs/api/fhir/datatypes/substanceamount/index.html): Base StructureDefinition for SubstanceAmount Type: Chemical substances are a single substance type whose primary defining element is the molecular structure. Chemical substances shall be defined on the basis of their complete covalent molecular structure; the presence of a salt (counter-ion) and/or solvates (water, alcohols) is also captured. Purity, grade, physical form or particle size are not taken into account in the definition of a chemical substance or in the assignment of a Substance ID. (863 words) - [The Sign In Page | Medplum](/content/docs/app/sign-in-page/index.html): Once a User accepts your invite, they will be able to log in to the Medplum App at https://app.medplum.com/signin. (164 words) - [UserInfo endpoint | Medplum](/content/docs/api/oauth/userinfo/index.html): The /oauth2/userinfo endpoint returns information about the authenticated user. (195 words) - [23 posts tagged with "community" | Medplum](/content/blog/tags/community/index.html) (657 words) - [Agent Upgrade | Medplum](/content/docs/agent/upgrade/index.html): Remotely upgrades the Medplum Agent software for a given agent or agents. Useful for rolling out new agent versions without needing physical or remote access to the host machine running the agent. (785 words) - [DicomInstance | Medplum](/content/docs/api/fhir/medplum/dicominstance/index.html): Definition of a DICOM instance, which represents a single DICOM image and related metadata that are part of a DICOM series. (601 words) - [Medplum App | Medplum](/content/docs/app/index.html): The Medplum App is a user-facing web application available at https://app.medplum.com/ targeted towards developers and project administrators. The app is a quick way to administer projects, manage users, and inspect resources. (106 words) - [OAuth2 | Medplum](/content/docs/api/oauth/index.html): OAuth2 Authentication (360 words) - [Intro to Medplum Agent | Medplum](/content/docs/agent/index.html): The Medplum Agent is an application that runs inside your firewall and connects to devices over low level protocols such as HL7/MLLP, ASTM, and DICOM. These network protocols are commonly unencrypted, and therefore require an adapter to a secure transport. The Medplum Agent uses secure HTTPS WebSocket channels to stream messages between devices and a Medplum server cluster in the cloud. (1,207 words) - [Overview | Medplum](/content/docs/api/scim/overview/index.html): Medplum user management supports SCIM (System for Cross-domain Identity Management), the open API for managing identities. (30 words) - [Medplum MCP | Medplum](/content/docs/ai/mcp/index.html): Welcome to the official documentation for the Medplum MCP integration. This guide provides an in-depth look at how to set up and use the integration, detailing the available tools and providing practical examples to help you get started. (1,092 words) - [DeviceMetric | Medplum](/content/docs/api/fhir/resources/devicemetric/index.html): Describes a measurement, calculation or setting capability of a medical device. (1,215 words) - [SMART App Launch | Medplum](/content/docs/integration/smart-app-launch/index.html): Medplum is an open source implementation of SMART App Launch 2.0.0. This guide will walk through how to set up and test your SMART App Launch links and test your application. (626 words) - [AsyncJob | Medplum](/content/docs/api/fhir/medplum/asyncjob/index.html): Contains details of long running asynchronous/background jobs. (578 words) - [Integrations and Interoperability Engine | Medplum](/content/products/integration/index.html): Medplum offers a powerful integration and interoperability engine that speaks common healthcare "languages" (FHIR, HL7, SFTP, CCD-A and more). This is the most commonly used feature of Medplum. It can be used to receive data from and send data to other systems - medical or cloud based. (778 words) - [TestScript | Medplum](/content/docs/api/fhir/resources/testscript/index.html): A structured set of tests against a FHIR server or client implementation to determine compliance against the FHIR specification. (13,147 words) - [CatalogEntry | Medplum](/content/docs/api/fhir/resources/catalogentry/index.html): Catalog entries are wrappers that contextualize items included in a catalog. (765 words) - [Agent Reload Config | Medplum](/content/docs/agent/reload-config/index.html): Remotely reloads the configuration of a given agent or agents from the Medplum Server. Useful for pushing changes made to an Agent resource (such as adding, removing, or modifying channels) to a running agent without restarting the agent service. (631 words) - [React Components | Medplum](/content/docs/api/react/index.html): Medplum ships a set of React components to help you speed up your app development. We've found these components to be especially useful in the healthcare domain, and we use them ourselves in out Medplum Web App. (58 words) - [One doc tagged with "DiagnosticReport" | Medplum](/content/docs/tags/diagnostic-report/index.html) (49 words) - [ConceptMap | Medplum](/content/docs/api/fhir/resources/conceptmap/index.html): A statement of relationships from one set of concepts to one or more other concepts - either concepts in code systems, or data element/data element concepts, or classes in class models. (677 words) - [ASTM Channels | Medplum](/content/docs/agent/astm-channels/index.html): Clinical analyzers — Bio-Rad, Beckman, Roche, and many others — commonly speak ASTM E1381 (the (1,209 words) - [ProductShelfLife | Medplum](/content/docs/api/fhir/datatypes/productshelflife/index.html): Base StructureDefinition for ProductShelfLife Type: The shelf-life and storage information for a medicinal product item or container can be described using this class. (648 words) - [3 docs tagged with "loinc" | Medplum](/content/docs/tags/loinc/index.html) (122 words) - [Binary Security Context | Medplum](/content/docs/access/binary-security-context/index.html): FHIR Binary resources require special attention when implementing access controls in Medplum. Unlike other FHIR resources, Binary resources cannot use standard compartment-based access policies and must rely on the securityContext element for proper access control. (720 words) - [QuestionnaireResponse $extract | Medplum](/content/docs/api/fhir/operations/extract/index.html): The $extract operation transforms completed questionnaire responses into structured FHIR resources. This bridges the gap between form-based data collection and your clinical data model-automatically converting patient intake forms, assessments, or surveys into Observations, Conditions, Procedures, and other FHIR resources. (279 words) - [Parameters $ai | Medplum](/content/docs/api/fhir/operations/ai/index.html): The $ai operation provides an interface for calling AI language models (like OpenAI's GPT) through Medplum. This operation supports both standard request/response and streaming modes. (602 words) - [ContactPoint | Medplum](/content/docs/api/fhir/datatypes/contactpoint/index.html): Base StructureDefinition for ContactPoint Type: Details for all kinds of technology mediated contact points for a person or organization, including telephone, email, etc. (386 words) - [Custom EHR | Medplum](/content/solutions/custom-ehr/index.html): Medplum is a platform on which to build acompliant, custom electronic health record system. Providers need an ergonomic and automatied software suite to smooth workflow, productivity and protocol compliance. Medplum provides the infrasturcture, integrations and compliance that reduce the time to build a custom solution by up to 80%. (368 words) - [Annotation | Medplum](/content/docs/api/fhir/datatypes/annotation/index.html): Base StructureDefinition for Annotation Type: A text note which also contains information about who made the statement and when. (243 words) - [Medplum Brand Assets | Medplum](/content/brand/index.html): Logo (93 words) - [19 posts tagged with "integration" | Medplum](/content/blog/tags/integration/page/2/index.html) (478 words) - [One doc tagged with "pharmacy" | Medplum](/content/docs/tags/pharmacy/index.html) (42 words) - [Upgrading Medplum Server | Medplum](/content/docs/self-hosting/upgrading-server/index.html): Keeping your Medplum server up-to-date ensures you get the latest security patches, new features, and performance improvements while maintaining compliance with healthcare regulations. (497 words) - [Modeling your Provider Directory | Medplum](/content/docs/administration/provider-directory/index.html): Provider Directories are critical databases housing essential details about healthcare providers, from individual practitioners to entire organizations. Accurate and standardized modeling of these directories, ensures a better patient experience via improved coordination coordination of care and operational efficiency. (305 words) - [One doc tagged with "tasks" | Medplum](/content/docs/tags/tasks/index.html) (35 words) - [One doc tagged with "consent" | Medplum](/content/docs/tags/consent/index.html) (54 words) - [2 posts tagged with "billing" | Medplum](/content/blog/tags/billing/index.html) (197 words) - [2 docs tagged with "subscriptions" | Medplum](/content/docs/tags/subscriptions/index.html) (130 words) - [Install on AWS | Medplum](/content/docs/self-hosting/install-on-aws/index.html): This guide will perform a complete production-ready installation in your AWS environment using AWS CDK. (1,693 words) - [core.token | Medplum](/content/docs/sdk/core-token.html): Home > @medplum/core > Token (22 words) - [UserConfiguration | Medplum](/content/docs/api/fhir/medplum/userconfiguration/index.html): User specific configuration for the Medplum application. (593 words) - [CoverageEligibilityResponse | Medplum](/content/docs/api/fhir/resources/coverageeligibilityresponse/index.html): This resource provides eligibility and plan details from the processing of an CoverageEligibilityRequest resource. (483 words) - [Encounter | Medplum](/content/docs/api/fhir/resources/encounter/index.html): An interaction between a patient and healthcare provider(s) for the purpose of providing healthcare service(s) or assessing the health status of a patient. Refer to the US Core Encounter Profile and the US Core Condition Encounter profile. (3,332 words) - [core.toomanyrequests | Medplum](/content/docs/sdk/core-toomanyrequests.html): Home > @medplum/core > tooManyRequests (7 words) - [5 docs tagged with "bots" | Medplum](/content/docs/tags/bots/index.html) (224 words) - [core.createpdffunction | Medplum](/content/docs/sdk/core-createpdffunction.html): Home > @medplum/core > CreatePdfFunction (8 words) - [core.isbrowserenvironment | Medplum](/content/docs/sdk/core-isbrowserenvironment.html): Home > @medplum/core > isBrowserEnvironment (29 words) - [One doc tagged with "tutorial" | Medplum](/content/docs/tags/tutorial/index.html) (47 words) - [Install on Ubuntu | Medplum](/content/docs/self-hosting/install-on-ubuntu/index.html): This guide provides step-by-step instructions for deploying Medplum on Ubuntu using our official APT repository. The installation process is streamlined through package management while maintaining the robustness and security required for production environments. This guide was tested on Ubuntu 24.04 but is compatible with most recent Ubuntu versions. (685 words) - [2 docs tagged with "labs" | Medplum](/content/docs/tags/labs/index.html) (90 words) - [One post tagged with "geriatrics" | Medplum](/content/blog/tags/geriatrics/index.html) (301 words) - [core.getschedulingtimezone | Medplum](/content/docs/sdk/core-getschedulingtimezone.html): Home > @medplum/core > getSchedulingTimezone (116 words) - [Admin Users | Medplum](/content/docs/access/admin/index.html): Certain operations require Medplum Users, Bots, or ClientApplications to have administrative privileges. Users can be granted admin rights on a per-project basis: a given user can be an admin for one project, but not another. (397 words) - [AccessPolicy | Medplum](/content/docs/api/fhir/medplum/accesspolicy/index.html): Access Policy for user or user group that defines how entities can or cannot access resources. (578 words) - [core.hasschedulingparameters | Medplum](/content/docs/sdk/core-hasschedulingparameters.html): Home > @medplum/core > hasSchedulingParameters (72 words) - [Meta | Medplum](/content/docs/api/fhir/datatypes/meta/index.html): Base StructureDefinition for Meta Type: The metadata about a resource. This is content in the resource that is maintained by the infrastructure. Changes to the content might not always be associated with version changes to the resource. (597 words) - [core.createbinaryoptions.onprogress | Medplum](/content/docs/sdk/core-createbinaryoptions-onprogress.html): Home > @medplum/core > CreateBinaryOptions > onProgress (25 words) - [core.medicationcartremoverequest.medicationrequestid | Medplum](/content/docs/sdk/core-medicationcartremoverequest-medicationrequestid.html): Home > @medplum/core > MedicationCartRemoveRequest > medicationRequestId (9 words) - [core.mailoptions.to | Medplum](/content/docs/sdk/core-mailoptions-to.html): Home > @medplum/core > MailOptions > to (26 words) - [Access Token Management | Medplum](/content/docs/auth/session-management/index.html): This guide explains how Medplum manages authentication tokens and how to implement secure token handling in your applications. (511 words) - [core.subscriptionmanager.reconnectwebsocket | Medplum](/content/docs/sdk/core-subscriptionmanager-reconnectwebsocket.html): Home > @medplum/core > SubscriptionManager > reconnectWebSocket (8 words) - [core.hl7message.parse | Medplum](/content/docs/sdk/core-hl7message-parse.html): Home > @medplum/core > Hl7Message > parse (32 words) - [Running the Full Medplum Stack in Docker | Medplum](/content/docs/self-hosting/running-full-medplum-stack-in-docker/index.html): Medplum provides a Docker Compose file which comes with everything you need to get started in just two commands: (106 words) - [core.marker.index | Medplum](/content/docs/sdk/core-marker-index.html): Home > @medplum/core > Marker > index (13 words) - [core.fhirfilterexpression | Medplum](/content/docs/sdk/core-fhirfilterexpression.html): Home > @medplum/core > FhirFilterExpression (33 words) - [34 posts tagged with "fhir-datastore" | Medplum](/content/blog/tags/fhir-datastore/page/2/index.html) (614 words) - [EffectEvidenceSynthesis | Medplum](/content/docs/api/fhir/resources/effectevidencesynthesis/index.html): The EffectEvidenceSynthesis resource describes the difference in an outcome between exposures states in a population where the effect estimate is derived from a combination of research studies. (200 words) - [Narrative | Medplum](/content/docs/api/fhir/datatypes/narrative/index.html): Base StructureDefinition for Narrative Type: A human-readable summary of the resource conveying the essential clinical and business information for the resource. (297 words) - [One doc tagged with "agentic-engineering" | Medplum](/content/docs/tags/agentic-engineering/index.html) (422 words) - [Client Credentials | Medplum](/content/docs/auth/client-credentials/index.html): The Medplum API uses standard OAuth2/OpenID authentication. The "Client Credentials Flow" is recommended for machine-to-machine access. (211 words) - [core.medplumsourceinfraconfig.workerservices | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-workerservices.html): Home > @medplum/core > MedplumSourceInfraConfig > workerServices (63 words) - [BiologicallyDerivedProduct | Medplum](/content/docs/api/fhir/resources/biologicallyderivedproduct/index.html): A material substance originating from a biological entity intended to be transplanted or infused (402 words) - [OpenTelemetry | Medplum](/content/docs/self-hosting/opentelemetry/index.html): This page describes Medplum's optional OpenTelemetry support, and how to integrate with AWS CloudWatch. (637 words) - [10 docs tagged with "messaging" | Medplum](/content/docs/tags/messaging/index.html) (370 words) - [One doc tagged with "longitudinal tracking" | Medplum](/content/docs/tags/longitudinal-tracking/index.html) (57 words) - [core.mockasyncclientstorage.isinitialized | Medplum](/content/docs/sdk/core-mockasyncclientstorage-isinitialized.html): Home > @medplum/core > MockAsyncClientStorage > isInitialized (9 words) - [Setting Medplum Server Configuration | Medplum](/content/docs/self-hosting/setting-configuration/index.html): There are two primary ways to configure the Medplum server when self-hosting: through a JSON configuration file or by using environment variables. This guide will walk you through both methods. (640 words) - [Building a Tenant Selector | Medplum](/content/docs/access/tenant-selector/index.html): This document is a follow-up to Multi-Tenant Access Control. (728 words) - [Monitoring Your Self-Hosted Medplum Instance | Medplum](/content/docs/self-hosting/monitoring/index.html): When running a self-hosted Medplum instance, proper monitoring is essential for maintaining system health and performance. This guide covers the key metrics Medplum recommends self-hosting users to track and what information they surface about your deployment. (1,139 words) - [One doc tagged with "workflow" | Medplum](/content/docs/tags/workflow/index.html) (516 words) - [One post tagged with "forward-deployed-engineering" | Medplum](/content/blog/tags/forward-deployed-engineering/index.html) (163 words) - [CodeSystem | Medplum](/content/docs/api/fhir/resources/codesystem/index.html): The CodeSystem resource is used to declare the existence of and describe a code system or code system supplement and its key properties, and optionally define a part or all of its content. (343 words) - [Population | Medplum](/content/docs/api/fhir/datatypes/population/index.html): Base StructureDefinition for Population Type: A populatioof people with some set of grouping criteria. (207 words) - [Modeling Provider Networks | Medplum](/content/docs/administration/provider-directory/provider-networks/index.html): Introduction (468 words) - [One doc tagged with "asynchronous" | Medplum](/content/docs/tags/asynchronous/index.html) (310 words) - [Scheduling | Medplum](/content/products/scheduling/index.html): Scheduling platform that supports clinical workflows such as clinician or location filtering, patient slot selection, custom notifications, pre-appointment forms and more. Medplum supports the full range of scheduling scenarios from very simple single schedule with slots, to a complex scheduling requirements with facilities, equipment and constraints requirements. (509 words) - [Solutions | Medplum](/content/solutions/index.html) (393 words) - [core.ratelimitinfo | Medplum](/content/docs/sdk/core-ratelimitinfo.html): Home > @medplum/core > RateLimitInfo (19 words) - [Period | Medplum](/content/docs/api/fhir/datatypes/period/index.html): Base StructureDefinition for Period Type: A time period defined by a start and end date and optionally time. (286 words) - [The _filter Search Parameter | Medplum](/content/docs/search/filter-search-parameter/index.html): The _filter parameter extends FHIR's search functionality by allowing you to narrow down your results using complex filter expressions. It is a useful way to filter resources in a way that may not be easily achievable using standard parameters. (718 words) - [CodeSystem $subsumes | Medplum](/content/docs/api/fhir/operations/codesystem-subsumes/index.html): The $subsumes operation tests whether one code is a parent (more general) or child (more specific) of another code within a hierarchical code system. This is crucial for clinical decision support, where you need to determine if a specific diagnosis or procedure falls under a broader category. (378 words) - [Modeling Provider Organizations | Medplum](/content/docs/administration/provider-directory/provider-organizations/index.html): Introduction (969 words) - [Reading Data | Medplum](/content/docs/fhir-datastore/reading-data/index.html): A very common operation is reading the data of a specified resource given its id. The FHIR read operation is used by sending an HTTP GET request. (152 words) - [core.typedeventtarget.listenercount | Medplum](/content/docs/sdk/core-typedeventtarget-listenercount.html): Home > @medplum/core > TypedEventTarget > listenerCount (44 words) - [Extension | Medplum](/content/docs/api/fhir/datatypes/extension/index.html): Base StructureDefinition for Extension Type: Optional Extension Element - found in all resources. (318 words) - [Project $clone | Medplum](/content/docs/api/fhir/operations/project-clone/index.html): The $clone operation creates a complete copy of a Medplum project, including all its resources. This is useful for creating test environments, project templates, or migrating projects. (456 words) - [ProdCharacteristic | Medplum](/content/docs/api/fhir/datatypes/prodcharacteristic/index.html): Base StructureDefinition for ProdCharacteristic Type: The marketing status describes the date when a medicinal product is actually put on the market or the date as of which it is no longer available. (1,048 words) - [Charting | Medplum](/content/docs/charting/index.html): The Charting Decision Guide walks through requirements questions and FHIR modeling decisions for charting — use it alongside these docs. (181 words) - [ValueSet $expand | Medplum](/content/docs/api/fhir/operations/valueset-expand/index.html): The $expand operation returns all codes contained in a ValueSet, making it ideal for populating dropdown menus, typeahead search fields, and code pickers in clinical applications. Instead of storing and managing large code lists client-side, you can dynamically fetch the allowed values for any coded field. (396 words) - [core.medpluminfraconfig.clamscanloggingprefix | Medplum](/content/docs/sdk/core-medpluminfraconfig-clamscanloggingprefix.html): Home > @medplum/core > MedplumInfraConfig > clamscanLoggingPrefix (17 words) - [Self-hosting Medplum | Medplum](/content/docs/self-hosting/index.html): Medplum is an open source healthcare development platform that you can deploy in your own environment. This guide provides detailed instructions for self-hosting Medplum across various infrastructure options. (291 words) - [RelatedArtifact | Medplum](/content/docs/api/fhir/datatypes/relatedartifact/index.html): Base StructureDefinition for RelatedArtifact Type: Related artifacts such as additional documentation, justification, or bibliographic references. (394 words) - [core.subscriptioneventmap | Medplum](/content/docs/sdk/core-subscriptioneventmap.html): Home > @medplum/core > SubscriptionEventMap (68 words) - [ExplanationOfBenefit | Medplum](/content/docs/api/fhir/resources/explanationofbenefit/index.html): This resource provides: the claim details; adjudication details from the processing of a Claim; and optionally account balance information, for informing the subscriber of the benefits provided. (14,831 words) - [core.inviterequest.patient | Medplum](/content/docs/sdk/core-inviterequest-patient.html): Home > @medplum/core > InviteRequest > patient (39 words) - [core.hl7field.context | Medplum](/content/docs/sdk/core-hl7field-context.html): Home > @medplum/core > Hl7Field > context (8 words) - [core.datasampler | Medplum](/content/docs/sdk/core-datasampler.html): Home > @medplum/core > DataSampler (32 words) - [core.iclientstorage.getstring | Medplum](/content/docs/sdk/core-iclientstorage-getstring.html): Home > @medplum/core > IClientStorage > getString (27 words) - [core.filter.operator | Medplum](/content/docs/sdk/core-filter-operator.html): Home > @medplum/core > Filter > operator (7 words) - [4 docs tagged with "charting" | Medplum](/content/docs/tags/charting/index.html) (236 words) - [Blog | Medplum](/content/blog/page/8/index.html): Blog (443 words) - [PackageInstallation | Medplum](/content/docs/api/fhir/medplum/packageinstallation/index.html): Definition of a marketplace package installation, which represents the installation of a specific package release in a system. (463 words) - [Agent Status | Medplum](/content/docs/agent/status/index.html): Gets the status of a given agent. Useful for seeing whether an agent is connected and listing its current software version. (129 words) - [3 docs tagged with "security" | Medplum](/content/docs/tags/security/index.html) (169 words) - [core.invalid_medication_search_response | Medplum](/content/docs/sdk/core-invalid_medication_search_response.html): Home > @medplum/core > INVALID\MEDICATION\SEARCH\RESPONSE (22 words) - [ChargeItemDefinition $apply | Medplum](/content/docs/api/fhir/operations/chargeitemdefinition-apply/index.html): The $apply operation applies a ChargeItemDefinition resource to a specific ChargeItem, calculating the appropriate pricing based on the definition's property groups and applicability rules. (284 words) - [core.iwebsocket.open | Medplum](/content/docs/sdk/core-iwebsocket-open.html): Home > @medplum/core > IWebSocket > OPEN (14 words) - [core.medicationorderrequest.pharmacyncpdpid | Medplum](/content/docs/sdk/core-medicationorderrequest-pharmacyncpdpid.html): Home > @medplum/core > MedicationOrderRequest > pharmacyNcpdpId (9 words) - [Load Testing | Medplum](/content/docs/self-hosting/load-testing/index.html): Medplum is designed to be a critical component of system architecture. It is important that Medplum server is robust, performant, and scalable. But no matter how well designed, the capacity of the server will eventually be limited by the hardware it runs on. Therefore, it is also important to understand how Medplum server responds under extreme load, such as how and when the server will break. (1,135 words) - [core.preferredpharmacy.organizationref | Medplum](/content/docs/sdk/core-preferredpharmacy-organizationref.html): Home > @medplum/core > PreferredPharmacy > organizationRef (8 words) - [Agent Stats | Medplum](/content/docs/agent/stats/index.html): Fetches runtime statistics from a given agent or agents. Useful for monitoring connection counts, queue depths, RTT metrics, and overall agent health. (627 words) - [core.medplumclient.setactivelogin | Medplum](/content/docs/sdk/core-medplumclient-setactivelogin.html): Home > @medplum/core > MedplumClient > setActiveLogin (28 words) - [One doc tagged with "coverage" | Medplum](/content/docs/tags/coverage/index.html) (449 words) - [Subscriptions | Medplum](/content/docs/subscriptions/index.html): Subscriptions are event-driven notifications, like webhooks, and are commonly used for integrations and automations. Medplum supports subscribing to changes on FHIR resources. There is a description FHIR Subscriptions on HL7.org that describes the functionality in detail. (160 words) - [core.fhircastencounteropencontext | Medplum](/content/docs/sdk/core-fhircastencounteropencontext.html): Home > @medplum/core > FhircastEncounterOpenContext (15 words) - [One post tagged with "genomics" | Medplum](/content/blog/tags/genomics/index.html) (87 words) - [One post tagged with "bots" | Medplum](/content/blog/tags/bots/index.html) (44 words) - [One doc tagged with "billing" | Medplum](/content/docs/tags/billing/index.html) (14 words) - [Expression | Medplum](/content/docs/api/fhir/datatypes/expression/index.html): Base StructureDefinition for Expression Type: A expression that is evaluated in a specified context and returns a value. The context of use of the expression must specify the context in which the expression is evaluated, and how the result of the expression is used. (322 words) - [Provider Portal | Medplum](/content/solutions/provider-portal/index.html): Allowing physicians who belong to multiple practices to have access to patient data as needed for care is a common scenario. Medplum provides a starter kit to build a provider portal with a custom experience. Practices and companies consider a custom portal when an off-the-shelf solution has low engagement because it is too confusing or complex for referring physicians or other stakeholders. (578 words) - [core.isatom | Medplum](/content/docs/sdk/core-isatom.html): Home > @medplum/core > IsAtom (35 words) - [core.medplumclient.startasyncrequest | Medplum](/content/docs/sdk/core-medplumclient-startasyncrequest.html): Home > @medplum/core > MedplumClient > startAsyncRequest (51 words) - [Tutorials | Medplum](/content/docs/tutorials/index.html): Welcome to the Medplum tutorials! This section contains several tutorials designed to introduce you to the core concepts of Medplum and build a simple application. This series of tutorials is designed to be completed in under an hour. (49 words) - [core.eventlistener_2 | Medplum](/content/docs/sdk/core-eventlistener_2.html): Home > @medplum/core > EventListener\2 (21 words) - [Should you Self-Host? | Medplum](/content/docs/self-hosting/considerations/index.html): Self-hosting is part of the beauty of open source, and self-hosting Medplum can be the right choice for some teams. However, successful self-hosters of Medplum have highly skilled in-house SRE resources and make significant operational investments in order to maintain their self-hosted clusters. This guide helps you evaluate whether self-hosting aligns with your goals and resources. (954 words) - [Lab, LIS and Laboratory Networks | Medplum](/content/solutions/lab/index.html): Support a wide variety of lab use cases on a unified service. Medplum implementations been cleared by CLIA/CAP as a primary LIS, enable FHIR API access, and help to quickly develop patient portals and provider portals. (460 words) - [34 posts tagged with "fhir-datastore" | Medplum](/content/blog/tags/fhir-datastore/index.html) (984 words) - [One doc tagged with "mcp" | Medplum](/content/docs/tags/mcp/index.html) (141 words) - [One post tagged with "care plans" | Medplum](/content/blog/tags/care-plans/index.html) (48 words) - [One doc tagged with "CPOE" | Medplum](/content/docs/tags/cpoe/index.html) (41 words) - [One post tagged with "mso" | Medplum](/content/blog/tags/mso/index.html) (52 words) - [One doc tagged with "registration" | Medplum](/content/docs/tags/registration/index.html) (62 words) - [core.moveoperation.from | Medplum](/content/docs/sdk/core-moveoperation-from.html): Home > @medplum/core > MoveOperation > from (7 words) - [Modeling Provider Qualifications | Medplum](/content/docs/administration/provider-directory/provider-credentials/index.html): Introduction (798 words) - [One doc tagged with "upgrades" | Medplum](/content/docs/tags/upgrades/index.html) (28 words) - [core.getelementdefinitionforpath | Medplum](/content/docs/sdk/core-getelementdefinitionforpath.html): Home > @medplum/core > getElementDefinitionForPath (33 words) - [core.canreadresourcetype | Medplum](/content/docs/sdk/core-canreadresourcetype.html): Home > @medplum/core > canReadResourceType (61 words) - [MarketingStatus | Medplum](/content/docs/api/fhir/datatypes/marketingstatus/index.html): Base StructureDefinition for MarketingStatus Type: The marketing status describes the date when a medicinal product is actually put on the market or the date as of which it is no longer available. (813 words) - [core.moveoperation.path | Medplum](/content/docs/sdk/core-moveoperation-path.html): Home > @medplum/core > MoveOperation > path (7 words) - [Blog | Medplum](/content/blog/page/4/index.html): Blog (661 words) - [Pre-Authorized Code | Medplum](/content/docs/auth/pre-authorized-code/index.html): Medplum supports the OAuth 2.0 pre-authorized code grant type, urnparamsgrant-type:pre-authorizedcode, as defined by OpenID for Verifiable Credential Issuance 1.0. This flow is useful for magic links and other issuer-initiated flows where user authentication and consent have already happened before the client asks Medplum for tokens. (504 words) - [10 posts tagged with "ai" | Medplum](/content/blog/tags/ai/index.html) (669 words) - [Dosage | Medplum](/content/docs/api/fhir/datatypes/dosage/index.html): Base StructureDefinition for Dosage Type: Indicates how the medication is/was taken or should be taken by the patient. (1,371 words) - [core.medplumsourceinfraconfig.mtlsinternetfacing | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-mtlsinternetfacing.html): Home > @medplum/core > MedplumSourceInfraConfig > mtlsInternetFacing (8 words) - [AsyncJob $cancel | Medplum](/content/docs/api/fhir/operations/asyncjob-cancel/index.html): The $cancel operation allows you to cancel a running asynchronous job. This is useful when you need to stop a long-running operation that is no longer needed. (394 words) - [Blog | Medplum](/content/blog/page/2/index.html): Blog (711 words) - [11 posts tagged with "interop" | Medplum](/content/blog/tags/interop/index.html) (605 words) - [core.hl7field | Medplum](/content/docs/sdk/core-hl7field.html): Home > @medplum/core > Hl7Field (136 words) - [core.resolvesmarthealthlinkparams.shlink | Medplum](/content/docs/sdk/core-resolvesmarthealthlinkparams-shlink.html): Home > @medplum/core > ResolveSmartHealthLinkParams > shlink (7 words) - [core.convertcontainedresourcestobundle | Medplum](/content/docs/sdk/core-convertcontainedresourcestobundle.html): Home > @medplum/core > convertContainedResourcesToBundle (76 words) - [core.hl7message.header | Medplum](/content/docs/sdk/core-hl7message-header.html): Home > @medplum/core > Hl7Message > header (13 words) - [core.hl7context | Medplum](/content/docs/sdk/core-hl7context.html): Home > @medplum/core > Hl7Context (90 words) - [Case Studies | Medplum](/content/case-studies/index.html) (237 words) - [Agent CLI Commands | Medplum](/content/docs/agent/agent-cli-commands/index.html): The Medplum CLI provides several commands for managing and interacting with agents. This document describes the available commands and their usage. See more about installing and using the Medplum CLI here. (667 words) - [Run as User | Medplum](/content/docs/bots/bot-run-as-user/index.html): By default, the AccessPolicy that is applied to a Medplum Bot is defined by the Bot's ProjectMembership. This can be useful for many cases where the Bot should have different access to resources than the user who triggered the Bot. (153 words) - [core.findresourceinbundle | Medplum](/content/docs/sdk/core-findresourceinbundle.html): Home > @medplum/core > findResourceInBundle (33 words) - [UserSecurityRequest | Medplum](/content/docs/api/fhir/medplum/usersecurityrequest/index.html): User security request for the 'forgot password' flow, email verification, etc. (529 words) - [Age | Medplum](/content/docs/api/fhir/datatypes/age/index.html): Base StructureDefinition for Age Type: A duration of time during which an organism (or a process) has existed. (362 words) - [One post tagged with "terminology" | Medplum](/content/blog/tags/terminology/index.html) (87 words) - [core.humannameformatoptions.suffix | Medplum](/content/docs/sdk/core-humannameformatoptions-suffix.html): Home > @medplum/core > HumanNameFormatOptions > suffix (7 words) - [CareTeam | Medplum](/content/docs/api/fhir/resources/careteam/index.html): The Care Team includes all the people and organizations who plan to participate in the coordination and delivery of care for a patient. Refer to the US Core CarePlan profile. (788 words) - [Agent-Side Configuration | Medplum](/content/docs/agent/configuration/index.html): This guide covers all local configuration options for the Medplum Agent, including how to configure the agent via command line arguments and the agent.properties file. (686 words) - [core.preciselessthanorequals | Medplum](/content/docs/sdk/core-preciselessthanorequals.html): Home > @medplum/core > preciseLessThanOrEquals (78 words) - [core.medplumsourceinfraconfig.environment | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-environment.html): Home > @medplum/core > MedplumSourceInfraConfig > environment (7 words) - [2 posts tagged with "react" | Medplum](/content/blog/tags/react/index.html) (97 words) - [AWS Athena Guide | Medplum](/content/docs/self-hosting/aws-athena-guide/index.html): When self-hosting on AWS, you may need to perform data analytics on production traffic. AWS CloudWatch is usually the starting point for basic analytics. But sometimes you need more granular control over specific queries, such as filtering by IP address, HTTP verb, or HTTP status code. (768 words) - [Tags | Medplum](/content/docs/tags/index.html) (102 words) - [One doc tagged with "FHIR" | Medplum](/content/docs/tags/fhir/index.html) (62 words) - [DICOM & DICOMweb | Medplum](/content/docs/dicom/index.html): Medplum stores medical imaging alongside the rest of the patient record. A modality or PACS sends (519 words) - [Business Operations Associate | Medplum](/content/careers/business-operations-associate/index.html): Business Operations Associate (606 words) - [StructureDefinition $expand-profile | Medplum](/content/docs/api/fhir/operations/structuredefinition-expand-profile/index.html): The $expand-profile operation expands a StructureDefinition profile by recursively loading all nested StructureDefinition resources referenced in the profile's element type definitions. This is useful for obtaining a complete set of profiles needed to validate or render resources conforming to a profile. (441 words) - [One doc tagged with "best-practices" | Medplum](/content/docs/tags/best-practices/index.html) (215 words) - [SmartAppLaunch | Medplum](/content/docs/api/fhir/medplum/smartapplaunch/index.html): This resource contains context details for a SMART App Launch. (507 words) - [core.conceptmaptranslateparameters.url | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-url.html): Home > @medplum/core > ConceptMapTranslateParameters > url (13 words) - [core.readinteractions | Medplum](/content/docs/sdk/core-readinteractions.html): Home > @medplum/core > readInteractions (13 words) - [Privacy Policy | Medplum](/content/privacy/index.html): Welcome to Medplum! Physicians and healthcare professionals who wish to use Medplum's software and services ("Licensed Application") are required to register for the service and provide certain registration information to Medplum. Accordingly, we have developed this Privacy Policy to describe our policies and procedures with respect to such information, as well as additional information that you provide to Medplum from time to time. This Privacy Policy applies only to registration data that is provided by the physicians who register for and use the Licensed Application. It does not apply to the content of the data and files that are transmitted through the Licensed Application. The security of the messages that are transmitted through our Licensed Application is governed by the HIPAA Security Rule. (1,135 words) - [Money | Medplum](/content/docs/api/fhir/datatypes/money/index.html): Base StructureDefinition for Money Type: An amount of economic utility in some recognized currency. (204 words) - [Creating Superbills | Medplum](/content/docs/billing/creating-superbills/index.html): Medplum supports customizable creation of superbills. (144 words) - [One doc tagged with "SMS" | Medplum](/content/docs/tags/sms/index.html) (33 words) - [Agent Bulk Status | Medplum](/content/docs/agent/bulk-status/index.html): Gets the status of an agent or agents based on given search criteria. Useful for seeing whether agents are connected and listing their current software version. (410 words) - [core.filebuilder.newline | Medplum](/content/docs/sdk/core-filebuilder-newline.html): Home > @medplum/core > FileBuilder > newLine (10 words) - [User Configuration | Medplum](/content/docs/access/user-configuration/index.html): The UserConfiguration resource is used to configure user-specific settings or settings that you want a group of users to share. To do this, you need to create a UserConfiguration resource and reference it in each of the Users's ProjectMembership resources that you want to apply the settings to. (243 words) - [11 posts tagged with "interop" | Medplum](/content/blog/tags/interop/page/2/index.html) (33 words) - [One doc tagged with "multi-tenant" | Medplum](/content/docs/tags/multi-tenant/index.html) (13 words) - [core.formathl7datetime | Medplum](/content/docs/sdk/core-formathl7datetime.html): Home > @medplum/core > formatHl7DateTime (38 words) - [Package | Medplum](/content/docs/api/fhir/medplum/package/index.html): Definition of a marketplace package, which represents a set of automated actions that can be taken by a system, such as a subscription or a workflow. (594 words) - [One doc tagged with "rollbacks" | Medplum](/content/docs/tags/rollbacks/index.html) (33 words) - [Communications and Messaging | Medplum](/content/products/communications/index.html): Communications platform that supports clinical workflows patient messaging a care team, communications regarding a care plan or appointment, sending messages to other EHRs, sending compliant emails, SMS notifications and video conferencing. (195 words) - [Token endpoint | Medplum](/content/docs/api/oauth/token/index.html): The /oauth2/token endpoint gets the user's tokens. (614 words) - [core.medicationcartitemresult.vendorlineid | Medplum](/content/docs/sdk/core-medicationcartitemresult-vendorlineid.html): Home > @medplum/core > MedicationCartItemResult > vendorLineId (19 words) - [ValueSet $validate-code | Medplum](/content/docs/api/fhir/operations/valueset-validate-code/index.html): The $validate-code operation checks whether a code is a valid member of a specific ValueSet. Unlike CodeSystem validation (which checks if a code exists anywhere in a code system), ValueSet validation confirms that a code is within the specific subset of codes allowed for a particular use-such as the list of valid allergy severity codes or permitted procedure types. (443 words) - [core.conceptmaptranslateparameters.code | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-code.html): Home > @medplum/core > ConceptMapTranslateParameters > code (7 words) - [Address | Medplum](/content/docs/api/fhir/datatypes/address/index.html): Base StructureDefinition for Address Type: An address expressed using postal conventions (as opposed to GPS or other location definition formats). This data type may be used to convey addresses for use in delivering mail as well as for visiting locations which might not be valid for mail delivery. There are a variety of postal address formats defined around the world. (594 words) - [ParameterDefinition | Medplum](/content/docs/api/fhir/datatypes/parameterdefinition/index.html): Base StructureDefinition for ParameterDefinition Type: The parameters to the module. This collection specifies both the input and output parameters. Input parameters are provided by the caller as part of the $evaluate operation. Output parameters are included in the GuidanceResponse. (329 words) - [Medplum Bot Layers | Medplum](/content/docs/bots/bot-lambda-layer/index.html): Overview of Medplum Bots (310 words) - [core.medplumclient.signinwithexternalauth | Medplum](/content/docs/sdk/core-medplumclient-signinwithexternalauth.html): Home > @medplum/core > MedplumClient > signInWithExternalAuth (75 words) - [core.fhircastmessagepayload | Medplum](/content/docs/sdk/core-fhircastmessagepayload.html): Home > @medplum/core > FhircastMessagePayload (25 words) - [Super Admin Guide | Medplum](/content/docs/self-hosting/super-admin-guide/index.html): When self-hosting a Medplum server, you will have access to a "Super Admin" project. When you sign in as a member of the "Super Admin" project, you will have access to very powerful super admin privileges. (620 words) - [Auth | Medplum](/content/docs/api/auth/index.html): Authentication API Reference (10 words) - [core.formatmoney | Medplum](/content/docs/sdk/core-formatmoney.html): Home > @medplum/core > formatMoney (24 words) - [One doc tagged with "signature" | Medplum](/content/docs/tags/signature/index.html) (54 words) - [Datadog Integration | Medplum](/content/docs/self-hosting/datadog/index.html): This page describes how to add the Datadog agent to your ECS Fargate tasks. Adding Datadog allows you to collect metrics from all containers. (171 words) - [CapabilityStatement | Medplum](/content/docs/api/fhir/resources/capabilitystatement/index.html): A Capability Statement documents a set of capabilities (behaviors) of a FHIR Server for a particular version of FHIR that may be used as a statement of actual server functionality or a statement of required or desired server implementation. (11,023 words) - [Agent Fetch Logs | Medplum](/content/docs/agent/fetch-logs/index.html): Fetches log entries from a given agent or agents. Useful for debugging and monitoring agent behavior. (714 words) - [core.matchesrange | Medplum](/content/docs/sdk/core-matchesrange.html): Home > @medplum/core > matchesRange (58 words) - [core.crawleroptions.initialpath | Medplum](/content/docs/sdk/core-crawleroptions-initialpath.html): Home > @medplum/core > CrawlerOptions > initialPath (7 words) - [core.mailoptions.subject | Medplum](/content/docs/sdk/core-mailoptions-subject.html): Home > @medplum/core > MailOptions > subject (19 words) - [One doc tagged with "fhir-datastore" | Medplum](/content/docs/tags/fhir-datastore/index.html) (48 words) - [One doc tagged with "SDC" | Medplum](/content/docs/tags/sdc/index.html) (76 words) - [core.hl7segment.tostring | Medplum](/content/docs/sdk/core-hl7segment-tostring.html): Home > @medplum/core > Hl7Segment > toString (42 words) - [Bot Secrets | Medplum](/content/docs/bots/bot-secrets/index.html): Introduction (208 words) - [34 posts tagged with "fhir-datastore" | Medplum](/content/blog/tags/fhir-datastore/page/4/index.html) (254 words) - [core.ilogger.warn | Medplum](/content/docs/sdk/core-ilogger-warn.html): Home > @medplum/core > ILogger > warn (34 words) - [AppointmentResponse | Medplum](/content/docs/api/fhir/resources/appointmentresponse/index.html): A reply to an appointment request for a patient and/or practitioner(s), such as a confirmation or rejection. (1,122 words) - [core.xoratom._constructor_ | Medplum](/content/docs/sdk/core-xoratom-_constructor_.html): Home > @medplum/core > XorAtom > (constructor) (22 words) - [Custom Operations | Medplum](/content/docs/api/fhir/operations/custom-operations/index.html): Medplum supports custom FHIR operations implemented via Bots. This allows you to define your own operations with custom business logic while following FHIR operation semantics. (196 words) - [Cron Jobs for Bots | Medplum](/content/docs/bots/bot-cron-job/index.html): You can add a cron job for your bot so it can automatically run from a schedule. This means you can set a repeatable time for the bot to automatically every minute, day, other month, etc. (165 words) - [core.internaltypeschema.version | Medplum](/content/docs/sdk/core-internaltypeschema-version.html): Home > @medplum/core > InternalTypeSchema > version (13 words) - [14 posts tagged with "auth" | Medplum](/content/blog/tags/auth/index.html) (725 words) - [Bot | Medplum](/content/docs/api/fhir/medplum/bot/index.html): Bot account for automated actions. (905 words) - [Creating CMS 1500 | Medplum](/content/docs/billing/creating-cms1500/index.html): Medplum supports customizable creation of CMS 1500 for use in billing. (146 words) - [One doc tagged with "drafts" | Medplum](/content/docs/tags/drafts/index.html) (47 words) - [ContactDetail | Medplum](/content/docs/api/fhir/datatypes/contactdetail/index.html): Base StructureDefinition for ContactDetail Type: Specifies contact information for a person or organization. (218 words) - [18 posts tagged with "self-host" | Medplum](/content/blog/tags/self-host/page/2/index.html) (373 words) - [Products | Medplum](/content/products/index.html): The platform underneath your healthcare product (1,019 words) - [Multi-Tenant Access Control | Medplum](/content/docs/access/multi-tenant-access-policy/index.html): Overview (522 words) - [core.medplumclientoptions.baseurl | Medplum](/content/docs/sdk/core-medplumclientoptions-baseurl.html): Home > @medplum/core > MedplumClientOptions > baseUrl (24 words) - [FHIR Operation Framework | Medplum](/content/docs/api/fhir/operations/index.html): In addition to the standard API endpoints for creating, reading, and updating resources, FHIR offers a variety of (1,201 words) - [One doc tagged with "read receipts" | Medplum](/content/docs/tags/read-receipts/index.html) (51 words) - [core.getpendingmedicationorderstatus | Medplum](/content/docs/sdk/core-getpendingmedicationorderstatus.html): Home > @medplum/core > getPendingMedicationOrderStatus (47 words) - [core.medicationcartclearrequesttoparameters | Medplum](/content/docs/sdk/core-medicationcartclearrequesttoparameters.html): Home > @medplum/core > medicationCartClearRequestToParameters (53 words) - [One doc tagged with "editing" | Medplum](/content/docs/tags/editing/index.html) (47 words) - [core.pushtoagentoptions.returnack | Medplum](/content/docs/sdk/core-pushtoagentoptions-returnack.html): Home > @medplum/core > PushToAgentOptions > returnAck (39 words) - [Consuming Webhooks | Medplum](/content/docs/bots/consuming-webhooks/index.html): Many SaaS products including popular services like Stripe and Okta support Webhooks, allowing a web application to register a Medplum URL to receive notifications. When a certain event occurs in the source application, such as a new user signup or a change to a record, the source application sends an HTTP POST request to the URL registered by the destination application. This HTTP POST request contains information about the event that occurred. (999 words) - [3 docs tagged with "threads" | Medplum](/content/docs/tags/threads/index.html) (131 words) - [Search | Medplum](/content/docs/search/index.html): Medplum supports searching and filtering FHIR resources using predefined search parameters specific to each resource type. You can query data via both the REST search API and GraphQL. (44 words) - [Full Stack Software Engineer | Medplum](/content/careers/fullstack-engineer/index.html): Full Stack Software Engineer (400 words) - [One post tagged with "tasks" | Medplum](/content/blog/tags/tasks/index.html) (48 words) - [MoneyQuantity | Medplum](/content/docs/api/fhir/datatypes/moneyquantity/index.html): An amount of money. With regard to precision, see Decimal Precision (297 words) - [core.hl7context.segmentseparator | Medplum](/content/docs/sdk/core-hl7context-segmentseparator.html): Home > @medplum/core > Hl7Context > segmentSeparator (8 words) - [One doc tagged with "extraction" | Medplum](/content/docs/tags/extraction/index.html) (76 words) - [Identifier | Medplum](/content/docs/api/fhir/datatypes/identifier/index.html): Base StructureDefinition for Identifier Type: An identifier - identifies some entity uniquely and unambiguously. Typically this is used for business identifiers. (471 words) - [Blog | Medplum](/content/blog/page/5/index.html): Blog (586 words) - [core.getparsedderivedidentifierexpression | Medplum](/content/docs/sdk/core-getparsedderivedidentifierexpression.html): Home > @medplum/core > getParsedDerivedIdentifierExpression (24 words) - [BodyStructure | Medplum](/content/docs/api/fhir/resources/bodystructure/index.html): Record details about an anatomical structure. This resource may be used when a coded concept does not provide the necessary detail needed for the use case. (647 words) - [core.resourcewithcode | Medplum](/content/docs/sdk/core-resourcewithcode.html): Home > @medplum/core > ResourceWithCode (20 words) - [Consent | Medplum](/content/docs/api/fhir/resources/consent/index.html): A record of a healthcare consumer’s choices, which permits or denies identified recipient(s) or recipient role(s) to perform one or more actions within a given policy context, for specific purposes and periods of time. (1,989 words) - [One doc tagged with "PlanDefinition" | Medplum](/content/docs/tags/plan-definition/index.html) (35 words) - [core.reconnectingwebsocket.reconnect | Medplum](/content/docs/sdk/core-reconnectingwebsocket-reconnect.html): Home > @medplum/core > ReconnectingWebSocket > reconnect (57 words) - [One doc tagged with "search" | Medplum](/content/docs/tags/search/index.html) (32 words) - [One post tagged with "hiring" | Medplum](/content/blog/tags/hiring/index.html) (171 words) - [core.medicationorderrequest.combinationmed | Medplum](/content/docs/sdk/core-medicationorderrequest-combinationmed.html): Home > @medplum/core > MedicationOrderRequest > combinationMed (12 words) - [ChargeItemDefinition | Medplum](/content/docs/api/fhir/resources/chargeitemdefinition/index.html): The ChargeItemDefinition resource provides the properties that apply to the (billing) codes necessary to calculate costs and prices. The properties may differ largely depending on type and realm, therefore this resource gives only a rough structure and requires profiling for each type of billing code system. (610 words) - [Patient $ccda-export | Medplum](/content/docs/api/fhir/operations/ccda-export/index.html): The $ccda-export operation generates a Consolidated Clinical Document Architecture (C-CDA) document for a patient. C-CDA is the industry-standard XML format for exchanging clinical summaries between healthcare systems, making this operation essential for interoperability and regulatory compliance. (577 words) - [Blog | Medplum](/content/blog/page/9/index.html): Blog (500 words) - [User | Medplum](/content/docs/api/fhir/medplum/user/index.html): Representation of a human user of the system. (703 words) - [One doc tagged with "lifecycle" | Medplum](/content/docs/tags/lifecycle/index.html) (51 words) - [core.fhirfilternegation._constructor_ | Medplum](/content/docs/sdk/core-fhirfilternegation-_constructor_.html): Home > @medplum/core > FhirFilterNegation > (constructor) (18 words) - [Why Medplum Is Open Source | Medplum](/content/open-source/index.html): Medplum exists because healthcare infrastructure needs to be more open, more interoperable, and more developer-friendly. (1,054 words) - [core.getinnerderivedidentifierexpression | Medplum](/content/docs/sdk/core-getinnerderivedidentifierexpression.html): Home > @medplum/core > getInnerDerivedIdentifierExpression (23 words) - [Access Policies | Medplum](/content/docs/access/access-policies/index.html): Introduction (759 words) - [core.notequalsatom._constructor_ | Medplum](/content/docs/sdk/core-notequalsatom-_constructor_.html): Home > @medplum/core > NotEqualsAtom > (constructor) (22 words) - [Resource $expunge | Medplum](/content/docs/api/fhir/operations/expunge/index.html): The $expunge operation permanently deletes a resource and all of its history from the database. Unlike a standard FHIR delete (which creates a "tombstone" record by marking it as deleted), expunge completely removes all traces of the resource. (434 words) - [DicomStudy | Medplum](/content/docs/api/fhir/medplum/dicomstudy/index.html): Definition of a DICOM study, which represents a collection of DICOM images and related metadata. (688 words) - [2 posts tagged with "pediatrics" | Medplum](/content/blog/tags/pediatrics/index.html) (68 words) - [core.findcodebysystem | Medplum](/content/docs/sdk/core-findcodebysystem.html): Home > @medplum/core > findCodeBySystem (58 words) - [core.fetchallversionstrings | Medplum](/content/docs/sdk/core-fetchallversionstrings.html): Home > @medplum/core > fetchAllVersionStrings (79 words) - [core.conceptmaptranslateparameters.coding | Medplum](/content/docs/sdk/core-conceptmaptranslateparameters-coding.html): Home > @medplum/core > ConceptMapTranslateParameters > coding (7 words) - [HumanName | Medplum](/content/docs/api/fhir/datatypes/humanname/index.html): Base StructureDefinition for HumanName Type: A human's name with the ability to identify parts and usage. (440 words) - [core.medplumsourceinfraconfig.loadbalanceralgorithm | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-loadbalanceralgorithm.html): Home > @medplum/core > MedplumSourceInfraConfig > loadBalancerAlgorithm (9 words) - [Build with AI on Medplum | Medplum](/content/docs/ai/index.html): The Reality of Healthcare AI (1,478 words) - [Distance | Medplum](/content/docs/api/fhir/datatypes/distance/index.html): Base StructureDefinition for Distance Type: A length - a value with a unit that is a physical distance. (302 words) - [core.mailoptions.sender | Medplum](/content/docs/sdk/core-mailoptions-sender.html): Home > @medplum/core > MailOptions > sender (26 words) - [Messaging Automations | Medplum](/content/docs/communications/messaging-automations/index.html): The patterns on this page use Medplum Bots — an advanced feature that is disabled by default on many projects — and FHIR Subscriptions. Recurring automations also use cron-scheduled Bots (Cron Jobs for Bots). Confirm Bots are enabled for your project and that you can create Bots and Subscriptions (typically as a Project administrator). (1,182 words) - [core.pharmacysearchparams.ncpdpid | Medplum](/content/docs/sdk/core-pharmacysearchparams-ncpdpid.html): Home > @medplum/core > PharmacySearchParams > ncpdpID (7 words) - [7 posts tagged with "monthly-update" | Medplum](/content/blog/tags/monthly-update/index.html) (637 words) - [One doc tagged with "episode of care" | Medplum](/content/docs/tags/episode-of-care/index.html) (57 words) - [core.preconditionfailed | Medplum](/content/docs/sdk/core-preconditionfailed.html): Home > @medplum/core > preconditionFailed (7 words) - [API Overview | Medplum](/content/docs/api/index.html): Welcome to the Medplum API reference. This section is intended as reference material, overview and how-to guides can be found in the Documentation section. The base URL for hosted Medplum is https://api.medplum.com/fhir/R4. (584 words) - [core.isobject | Medplum](/content/docs/sdk/core-isobject.html): Home > @medplum/core > isObject (43 words) - [core.medplumsourceinfraconfig.vpcid | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-vpcid.html): Home > @medplum/core > MedplumSourceInfraConfig > vpcId (8 words) - [core.moveoperation.op | Medplum](/content/docs/sdk/core-moveoperation-op.html): Home > @medplum/core > MoveOperation > op (13 words) - [PackageRelease | Medplum](/content/docs/api/fhir/medplum/packagerelease/index.html): Definition of a marketplace package release, which represents a specific release of a package that can be installed and used by a system. (524 words) - [Reference | Medplum](/content/docs/api/fhir/datatypes/reference/index.html): Base StructureDefinition for Reference Type: A reference from one resource to another. (931 words) - [core.prefixparselet | Medplum](/content/docs/sdk/core-prefixparselet.html): Home > @medplum/core > PrefixParselet (11 words) - [Install on GCP | Medplum](/content/docs/self-hosting/install-on-gcp/index.html): This document is intended to guide Medplum through the deployment of a comprehensive infrastructure on Google Cloud Platform (GCP) using Terraform. It provides detailed instructions and configurations necessary to set up essential components such as a Virtual Private Cloud (VPC), Google Kubernetes Engine (GKE) cluster, Cloud SQL database, Cloud Storage buckets, and Redis instances. The purpose is to ensure a smooth and efficient deployment process tailored to Medplum’s specific requirements, facilitating scalability, security, and high availability within their cloud environment. (1,414 words) - [One post tagged with "workflow" | Medplum](/content/blog/tags/workflow/index.html) (48 words) - [3 docs tagged with "LIMS" | Medplum](/content/docs/tags/lims/index.html) (122 words) - [ImplementationGuide | Medplum](/content/docs/api/fhir/resources/implementationguide/index.html): A set of rules of how a particular interoperability or standards problem is solved - typically through the use of FHIR resources. This resource is used to gather all the parts of an implementation guide into a logical whole and to publish a computable definition of all the parts. (463 words) - [core.agentstatprimitivevalue | Medplum](/content/docs/sdk/core-agentstatprimitivevalue.html): Home > @medplum/core > AgentStatPrimitiveValue (14 words) - [SMART Scopes | Medplum](/content/docs/access/smart-scopes/index.html): SMART on FHIR’s authorization scheme uses OAuth2 scopes to communicate (and negotiate) access requirements. (488 words) - [User Management Guide | Medplum](/content/docs/user-management/index.html): This guide walks through how to create and manage users via the Medplum App and via API. Medplum supports multiple authentication options, but always maintains a representation of the user identities, and gives developers control over which authentication method to use for an identity, as well as what access controls are applied. (503 words) - [core.reconnectingwebsocket.url | Medplum](/content/docs/sdk/core-reconnectingwebsocket-url.html): Home > @medplum/core > ReconnectingWebSocket > url (9 words) - [7 docs tagged with "subscription" | Medplum](/content/docs/tags/subscription/index.html) (234 words) - [3 docs tagged with "LIS" | Medplum](/content/docs/tags/lis/index.html) (122 words) - [core.pharmacysearchparams.state | Medplum](/content/docs/sdk/core-pharmacysearchparams-state.html): Home > @medplum/core > PharmacySearchParams > state (8 words) - [Binary $presigned-url | Medplum](/content/docs/api/fhir/operations/binary-presigned-url/index.html): Binary resources containing non-FHIR data such as images or PDF documents are often used to enrich and add context (252 words) - [core.subscriptionemitter._constructor_ | Medplum](/content/docs/sdk/core-subscriptionemitter-_constructor_.html): Home > @medplum/core > SubscriptionEmitter > (constructor) (18 words) - [core.medication_request_status_reason_system | Medplum](/content/docs/sdk/core-medication_request_status_reason_system.html): Home > @medplum/core > MEDICATION\REQUEST\STATUS\REASON\SYSTEM (57 words) - [Uptime, Availability, and SLAs | Medplum](/content/docs/uptime/index.html): There are two separate questions about uptime. The first is what Medplum commits to in a contract. The second is what Medplum has actually delivered in production. These are different things, and this page covers them separately. (591 words) - [ClientApplication $rotate-secret | Medplum](/content/docs/api/fhir/operations/rotate-client-secret/index.html): The $rotate-secret operation securely rotates client application credentials with zero downtime. It uses a two-phase rotation process: first moving the current secret to a "retiring" state while generating a new primary secret, then later removing the retiring secret—ensuring that active clients aren't immediately locked out during credential updates. (390 words) - [core.medplumsourceinfraconfig.apploggingbucket | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apploggingbucket.html): Home > @medplum/core > MedplumSourceInfraConfig > appLoggingBucket (7 words) - [One doc tagged with "imaging" | Medplum](/content/docs/tags/imaging/index.html) (37 words) - [26 docs tagged with "auth" | Medplum](/content/docs/tags/auth/index.html) (921 words) - [Resource $set-accounts | Medplum](/content/docs/api/fhir/operations/set-accounts/index.html): Medplum implements a custom $set-accounts operation to manage account references. This is the recommended way to manage account references for all resources. (388 words) - [core.reconnectingwebsocket._url | Medplum](/content/docs/sdk/core-reconnectingwebsocket-_url.html): Home > @medplum/core > ReconnectingWebSocket > \url (8 words) - [34 posts tagged with "fhir-datastore" | Medplum](/content/blog/tags/fhir-datastore/page/3/index.html) (288 words) - [Patient Portal | Medplum](/content/solutions/patient-portal/index.html): Build a patient facing application that allows users to view their records, fill out questionnaires, schedule appointments, message their provider, view care plans, manage coverage and more. Medplum provides a starter kit that accelerates development, is easy to customize and will scale with your organization. (329 words) - [ClientApplication | Medplum](/content/docs/api/fhir/medplum/clientapplication/index.html): Medplum client application for automated access. (723 words) - [Multi-Tenancy and Access Controls | Medplum](/content/solutions/compliance-security/tenanting-access/index.html): Medplum's multi-tenant architecture is designed specifically for healthcare organizations that need enterprise-grade data isolation while retaining flexibility to customize access with both roles within the organization and with external partners. Medplum architecture does this all while meeting regulatory requirements across jurisdictions, maintaining performance guarantees, and retaining the economic and organizational benefits of shared infrastructure. (513 words) - [core.medplumsourceinfraconfig.rdspersistentparametergroups | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdspersistentparametergroups.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsPersistentParameterGroups (7 words) - [Archive | Medplum](/content/blog/archive/index.html): Archive (741 words) - [4 posts tagged with "security" | Medplum](/content/blog/tags/security/index.html) (284 words) - [Medplum Resources | Medplum](/content/docs/api/fhir/medplum/index.html): Medplum Resource Reference (274 words) - [One post tagged with "interoperability" | Medplum](/content/blog/tags/interoperability/index.html) (72 words) - [One post tagged with "tenant" | Medplum](/content/blog/tags/tenant/index.html) (52 words) - [One doc tagged with "administration" | Medplum](/content/docs/tags/administration/index.html) (42 words) - [Blog | Medplum](/content/blog/index.html): Blog (1,072 words) - [One doc tagged with "routing" | Medplum](/content/docs/tags/routing/index.html) (49 words) - [2 docs tagged with "automation" | Medplum](/content/docs/tags/automation/index.html) (54 words) - [One doc tagged with "spaces" | Medplum](/content/docs/tags/spaces/index.html) (54 words) - [core.symbolatom.name | Medplum](/content/docs/sdk/core-symbolatom-name.html): Home > @medplum/core > SymbolAtom > name (8 words) - [core.globalschema | Medplum](/content/docs/sdk/core-globalschema.html): Home > @medplum/core > globalSchema (10 words) - [Logout | Medplum](/content/docs/auth/logout/index.html): There are two different methods to "logout" and revoke access tokens: (131 words) - [14 posts tagged with "auth" | Medplum](/content/blog/tags/auth/page/2/index.html) (217 words) - [One doc tagged with "access control" | Medplum](/content/docs/tags/access-control/index.html) (39 words) - [Careers | Medplum](/content/careers/index.html): Medplum is hiring (172 words) - [core.fhircastanchorresourcetype | Medplum](/content/docs/sdk/core-fhircastanchorresourcetype.html): Home > @medplum/core > FhircastAnchorResourceType (16 words) - [Install on Kubernetes | Medplum](/content/docs/self-hosting/install-on-kubernetes/index.html): This guide provides step-by-step instructions for deploying Medplum on any Kubernetes cluster using our official Helm chart. This approach is the recommended path for production deployments, as it leverages the full power of the Kubernetes ecosystem for scalability, high availability, and simplified management. (938 words) - [Testing emails with Mailtrap Email Sandbox | Medplum](/content/docs/self-hosting/mailtrapio/index.html): Mailtrap.io is an email platform for developer and product teams who need high inboxing rates and fast email delivery. It offers a flexible email API and a reliable SMTP service for developers to send transactional and bulk emails. (228 words) - [5 docs tagged with "Communication" | Medplum](/content/docs/tags/communication/index.html) (166 words) - [core.medplumsourceinfraconfig.apisslcertarn | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-apisslcertarn.html): Home > @medplum/core > MedplumSourceInfraConfig > apiSslCertArn (5 words) - [core.medicationorderdruginput.routedmedid | Medplum](/content/docs/sdk/core-medicationorderdruginput-routedmedid.html): Home > @medplum/core > MedicationOrderDrugInput > routedMedId (8 words) - [2 docs tagged with "bot" | Medplum](/content/docs/tags/bot/index.html) (111 words) - [core.hl7message.context | Medplum](/content/docs/sdk/core-hl7message-context.html): Home > @medplum/core > Hl7Message > context (8 words) - [core.medplumsourceinfraconfig.cachenodetype | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-cachenodetype.html): Home > @medplum/core > MedplumSourceInfraConfig > cacheNodeType (7 words) - [core.test_2 | Medplum](/content/docs/sdk/core-test_2.html): Home > @medplum/core > test\2 (109 words) - [Blog | Medplum](/content/blog/page/7/index.html): Blog (350 words) - [7 docs tagged with "integration" | Medplum](/content/docs/tags/integration/index.html) (210 words) - [CodeableConcept | Medplum](/content/docs/api/fhir/datatypes/codeableconcept/index.html): Base StructureDefinition for CodeableConcept Type: A concept that may be defined by a formal reference to a terminology or ontology or may be provided by text. (305 words) - [core.requestcacheentry | Medplum](/content/docs/sdk/core-requestcacheentry.html): Home > @medplum/core > RequestCacheEntry (28 words) - [Multiple Locations | Medplum](/content/docs/integration/health-gorilla/multiple-locations/index.html): This guide describes how to work with multiple locations in Health Gorilla. This is especially relevant for Management Services Organizations (MSOs) or practices with multiple clinic locations where different practitioners are assigned to different locations. (465 words) - [Care Plans | Medplum](/content/products/careplans/index.html): Medplum supports creating, managing and instantiating care plans for patients. Care plans go by many different names: care pathway, care journey, clinical protocol, onboarding or workflow. In principle, care plans describe a set of actions required as part of a patient's care. (716 words) - [Project $init | Medplum](/content/docs/api/fhir/operations/project-init/index.html): The $init operation creates a new Medplum Project with an admin user in a single API call. Projects provide isolated environments for different applications, organizations, or tenants-each with their own users, access policies, and FHIR resources. (299 words) - [CodeSystem $validate-code | Medplum](/content/docs/api/fhir/operations/codesystem-validate-code/index.html): Validating codes at the point of entry is necessary to prevent data quality issues that can cascade through analytics, clinical decision support, and interoperability workflows. Invalid codes can cause workflow failures, incorrect reports, and missed clinical alerts - all of which degrade clinical experiences. (300 words) - [One post tagged with "access-control" | Medplum](/content/blog/tags/access-control/index.html) (52 words) - [core.removeoperation.path | Medplum](/content/docs/sdk/core-removeoperation-path.html): Home > @medplum/core > RemoveOperation > path (8 words) - [2 posts tagged with "scheduling" | Medplum](/content/blog/tags/scheduling/index.html) (104 words) - [core.ispopulated | Medplum](/content/docs/sdk/core-ispopulated.html): Home > @medplum/core > isPopulated (82 words) - [core.issuetype | Medplum](/content/docs/sdk/core-issuetype.html): Home > @medplum/core > IssueType (22 words) - [core.getexpressionsforresourcetype | Medplum](/content/docs/sdk/core-getexpressionsforresourcetype.html): Home > @medplum/core > getExpressionsForResourceType (21 words) - [One doc tagged with "medications" | Medplum](/content/docs/tags/medications/index.html) (32 words) - [core.externalsecretprimitivetype | Medplum](/content/docs/sdk/core-externalsecretprimitivetype.html): Home > @medplum/core > ExternalSecretPrimitiveType (15 words) - [core.unauthorizedtokenexpired | Medplum](/content/docs/sdk/core-unauthorizedtokenexpired.html): Home > @medplum/core > unauthorizedTokenExpired (6 words) - [core.conceptmaptranslateoutput.message | Medplum](/content/docs/sdk/core-conceptmaptranslateoutput-message.html): Home > @medplum/core > ConceptMapTranslateOutput > message (7 words) - [core.reconnectingwebsocket.connecting | Medplum](/content/docs/sdk/core-reconnectingwebsocket-connecting.html): Home > @medplum/core > ReconnectingWebSocket > CONNECTING (9 words) - [core.inviterequest.forcenewmembership | Medplum](/content/docs/sdk/core-inviterequest-forcenewmembership.html): Home > @medplum/core > InviteRequest > forceNewMembership (8 words) - [core.createdocumentreferenceoptions.additionalfields | Medplum](/content/docs/sdk/core-createdocumentreferenceoptions-additionalfields.html): Home > @medplum/core > CreateDocumentReferenceOptions > additionalFields (17 words) - [core.getreferencestring | Medplum](/content/docs/sdk/core-getreferencestring.html): Home > @medplum/core > getReferenceString (50 words) - [core.medpluminfraconfig.hostedzonename | Medplum](/content/docs/sdk/core-medpluminfraconfig-hostedzonename.html): Home > @medplum/core > MedplumInfraConfig > hostedZoneName (7 words) - [core.medicationcheckoutrequesttoparameters | Medplum](/content/docs/sdk/core-medicationcheckoutrequesttoparameters.html): Home > @medplum/core > medicationCheckoutRequestToParameters (67 words) - [Claim | Medplum](/content/docs/api/fhir/resources/claim/index.html): A provider issued list of professional services and products which have been provided, or are to be provided, to a patient which is sent to an insurer for reimbursement. (9,632 words) - [Direct External Authentication | Medplum](/content/docs/auth/direct-external-auth/index.html): Medplum supports authenticating users directly with an external Identity Provider (IDP) access token, without requiring a token exchange or authorization code flow. This is useful when your application already holds a valid JWT from an external IDP and wants to access the Medplum API directly. (557 words) - [Multiple Practice Locations | Medplum](/content/docs/integration/scriptsure/multiple-locations/index.html): A single Medplum Project can serve many ScriptSure practice locations. This guide describes the data model and how prescribing resolves the correct practice per request. (423 words) - [Presigned URLs | Medplum](/content/docs/self-hosting/presigned-urls/index.html): Presigned URLs are a secure mechanism Medplum uses to serve binary content (images, videos, documents). (370 words) - [Pediatrics | Medplum](/content/solutions/pediatrics/index.html): Pediatrics implementations have unique characteristics that can make traditional EHRs challenging to use. Traditional EHRs have many assumptions built into them that assume an adult patient, which can make an existing interface confusing for practitioners, making visual customizations important. (217 words) - [3 docs tagged with "questionnaire" | Medplum](/content/docs/tags/questionnaire/index.html) (192 words) - [Duration | Medplum](/content/docs/api/fhir/datatypes/duration/index.html): Base StructureDefinition for Duration Type: A length of time. (294 words) - [core.invalidoperationerror.operation | Medplum](/content/docs/sdk/core-invalidoperationerror-operation.html): Home > @medplum/core > InvalidOperationError > operation (8 words) - [core.medpluminfraconfig.apiinternetfacing | Medplum](/content/docs/sdk/core-medpluminfraconfig-apiinternetfacing.html): Home > @medplum/core > MedplumInfraConfig > apiInternetFacing (8 words) - [core.prefixoperatoratom.child | Medplum](/content/docs/sdk/core-prefixoperatoratom-child.html): Home > @medplum/core > PrefixOperatorAtom > child (8 words) - [core.fhirfiltercomparison.operator | Medplum](/content/docs/sdk/core-fhirfiltercomparison-operator.html): Home > @medplum/core > FhirFilterComparison > operator (8 words) - [core.inviterequest.access | Medplum](/content/docs/sdk/core-inviterequest-access.html): Home > @medplum/core > InviteRequest > access (22 words) - [core.gettypedpropertyvaluewithpath | Medplum](/content/docs/sdk/core-gettypedpropertyvaluewithpath.html): Home > @medplum/core > getTypedPropertyValueWithPath (37 words) - [Billing and Payments | Medplum](/content/products/billing/index.html): Send data to your billing provider of choice. Easily connect to physician groups or bill through multiple professional corporations. Capture financial data and drive automated data transfer to other systems, such as a clearinghouse, revenue-cycle-management tool, payment processor, eligibility checker or medical biller. (301 words) - [Create a PDF | Medplum](/content/docs/bots/creating-a-pdf/index.html): You can use Medplum Bots to create a PDF file as an attachment. (412 words) - [Reset Password Endpoint | Medplum](/content/docs/api/auth/resetpassword/index.html): POST /auth/resetpassword (258 words) - [EnrollmentResponse | Medplum](/content/docs/api/fhir/resources/enrollmentresponse/index.html): This resource provides enrollment and plan details from the processing of an EnrollmentRequest resource. (439 words) - [Blog | Medplum](/content/blog/page/3/index.html): Blog (652 words) - [core.medplumsourceinfraconfig.rdsforceretain | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-rdsforceretain.html): Home > @medplum/core > MedplumSourceInfraConfig > rdsForceRetain (7 words) - [core.createreference | Medplum](/content/docs/sdk/core-createreference.html): Home > @medplum/core > createReference (39 words) - [core.agentconnectresponse | Medplum](/content/docs/sdk/core-agentconnectresponse.html): Home > @medplum/core > AgentConnectResponse (20 words) - [SOC2 Type II Certification | Medplum](/content/docs/compliance/soc2/index.html): Medplum has achieved SOC2 Type II certification. Customers can request materials in this section to support their own business needs our audit. (73 words) - [core.medpluminfraconfig.cacheredis | Medplum](/content/docs/sdk/core-medpluminfraconfig-cacheredis.html): Home > @medplum/core > MedplumInfraConfig > cacheRedis (17 words) - [ProjectMembership | Medplum](/content/docs/api/fhir/medplum/projectmembership/index.html): Medplum project membership. A project membership grants a user access to a project. (544 words) - [Bots | Medplum](/content/docs/bots/index.html): Medplum bots are functions that execute when triggered. They are similar to AWS Lambda functions, and in Medplum we make them easy to write and deploy and trigger with FHIR Subscriptions. For the purpose of the tutorials found in this section, it's important to understand that Bots drive many of the major integrations that you see in Medplum. (357 words) - [Project Settings | Medplum](/content/docs/self-hosting/project-settings/index.html): Many settings are also available at the Project level, allowing them to be configured for specific tenants on the server (835 words) - [One doc tagged with "results" | Medplum](/content/docs/tags/results/index.html) (49 words) - [AllergyIntolerance | Medplum](/content/docs/api/fhir/resources/allergyintolerance/index.html): Risk of harmful or undesirable, physiological response which is unique to an individual and associated with exposure to a substance. Refer to the US Core AllergyIntolerance profile details on representing specific substances, statuses and reaction types. (1,018 words) - [Medplum Enterprise | Medplum](/content/enterprise/index.html) (428 words) - [One doc tagged with "rxnorm" | Medplum](/content/docs/tags/rxnorm/index.html) (54 words) - [Messaging & Communications | Medplum](/content/docs/communications/index.html): The Messaging & Communications Decision Guide walks through requirements questions and FHIR modeling decisions for messaging — use it alongside these docs. (144 words) - [3 docs tagged with "task" | Medplum](/content/docs/tags/task/index.html) (135 words) - [19 posts tagged with "integration" | Medplum](/content/blog/tags/integration/index.html) (882 words) - [DeviceDefinition | Medplum](/content/docs/api/fhir/resources/devicedefinition/index.html): The characteristics, operational status and capabilities of a medical-related component of a medical device. (857 words) - [Welcome to Medplum | Medplum](/content/docs/index.html): Set up and run your medical application in 5 minutes (326 words) - [Project $rate-limits | Medplum](/content/docs/api/fhir/operations/project-rate-limits/index.html): The $rate-limits operation returns a snapshot of FHIR interaction quota usage for a project: consumed points, remaining points, configured limits, and time until reset. Use it to monitor load across the project and per membership (users, bots, and client applications). (560 words) - [core.hl7segment.get | Medplum](/content/docs/sdk/core-hl7segment-get.html): Home > @medplum/core > Hl7Segment > get (65 words) - [23 posts tagged with "community" | Medplum](/content/blog/tags/community/page/3/index.html) (128 words) - [Security | Medplum](/content/security/index.html): Security as a Company Value (1,744 words) - [One post tagged with "cardiology" | Medplum](/content/blog/tags/cardiology/index.html) (57 words) - [DomainConfiguration | Medplum](/content/docs/api/fhir/medplum/domainconfiguration/index.html): Domain specific configuration for the Medplum application. (496 words) - [Authors | Medplum](/content/blog/authors/index.html) (175 words) - [The Admin Page | Medplum](/content/docs/app/admin-page/index.html): The Admin Page of the Medplum App allows admin users to view and edit details of their project that normal users do not have access to. (246 words) - [core.marker | Medplum](/content/docs/sdk/core-marker.html): Home > @medplum/core > Marker (20 words) - [Manual Uninstall | Medplum](/content/docs/agent/manual-uninstall/index.html): The official agent installer for Microsoft Windows includes an uninstaller. However, if you need to manually uninstall the agent, follow these steps. (120 words) - [DicomSeries | Medplum](/content/docs/api/fhir/medplum/dicomseries/index.html): Definition of a DICOM series, which represents a collection of DICOM images and related metadata that are part of a DICOM study. (309 words) - [Troubleshooting | Medplum](/content/docs/agent/troubleshooting/index.html): Issue (200 words) - [Running Bots Locally | Medplum](/content/docs/bots/running-bots-locally/index.html): To set up the Medplum Bot framework locally, Medplum offers VM Context Bots. VM Context allows bots to spin up a local thread inside your server, rather than using an isolated lambda. (273 words) - [Pricing | Medplum](/content/pricing/index.html) (388 words) - [core.hl7message.setsegment | Medplum](/content/docs/sdk/core-hl7message-setsegment.html): Home > @medplum/core > Hl7Message > setSegment (98 words) - [AWS Advantages | Medplum](/content/docs/self-hosting/aws-advantages/index.html): Medplum provides a suite of digital healthcare services such as authentication, access controls, user management, FHIR server, automation, and more. (402 words) - [core.medicationcheckoutresponse.items | Medplum](/content/docs/sdk/core-medicationcheckoutresponse-items.html): Home > @medplum/core > MedicationCheckoutResponse > items (14 words) - [Patient $everything | Medplum](/content/docs/api/fhir/operations/patient-everything/index.html): The $everything operation retrieves a complete bundle of all resources associated with a patient in a single API call. This provides a comprehensive view of a patient's clinical record-including encounters, observations, medications, conditions, and related resources-without requiring multiple queries. (264 words) - [core.pharmacysearchparams | Medplum](/content/docs/sdk/core-pharmacysearchparams.html): Home > @medplum/core > PharmacySearchParams (48 words) - [core.hl7segment.context | Medplum](/content/docs/sdk/core-hl7segment-context.html): Home > @medplum/core > Hl7Segment > context (8 words) - [core.ilogger.debug | Medplum](/content/docs/sdk/core-ilogger-debug.html): Home > @medplum/core > ILogger > debug (28 words) - [StructureDefinition | Medplum](/content/docs/api/fhir/resources/structuredefinition/index.html): A definition of a FHIR structure. This resource is used to describe the underlying resources, data types defined in FHIR, and also for describing extensions and constraints on resources and data types. (589 words) - [core.hl7ackoptions.ackcode | Medplum](/content/docs/sdk/core-hl7ackoptions-ackcode.html): Home > @medplum/core > Hl7AckOptions > ackCode (8 words) - [Setting Up CORS | Medplum](/content/docs/self-hosting/setting-up-cors/index.html): When self-hosting, you may run into a CORS error when trying to run your app on https3000. If you do, you will need to ensure that you have set https3000 as an allowed origin on your server. (104 words) - [One post tagged with "performance" | Medplum](/content/blog/tags/performance/index.html) (74 words) - [core.conceptmaptranslatematch.equivalence | Medplum](/content/docs/sdk/core-conceptmaptranslatematch-equivalence.html): Home > @medplum/core > ConceptMapTranslateMatch > equivalence (7 words) - [core.isresource | Medplum](/content/docs/sdk/core-isresource.html): Home > @medplum/core > isResource (64 words) - [AWS CDK Settings Reference | Medplum](/content/docs/self-hosting/aws-cdk-settings/index.html): When deploying Medplum on AWS using the provided CDK, you will need to create a configuration file to define your infrastructure settings. This is a JSON file that contains all of the custom infrastructure configuration settings for your environment. (576 words) - [core.fhircastconnection | Medplum](/content/docs/sdk/core-fhircastconnection.html): Home > @medplum/core > FhircastConnection (135 words) - [core.filebuilder.indentcount | Medplum](/content/docs/sdk/core-filebuilder-indentcount.html): Home > @medplum/core > FileBuilder > indentCount (13 words) - [Push to Agent | Medplum](/content/docs/agent/push/index.html): Introduction (1,289 words) - [core.transformmapcollection._constructor_ | Medplum](/content/docs/sdk/core-transformmapcollection-_constructor_.html): Home > @medplum/core > TransformMapCollection > (constructor) (21 words) - [IdentityProvider | Medplum](/content/docs/api/fhir/medplum/identityprovider/index.html): External Identity Provider (IdP) configuration details. (150 words) - [core.medplumclientoptions.accesstoken | Medplum](/content/docs/sdk/core-medplumclientoptions-accesstoken.html): Home > @medplum/core > MedplumClientOptions > accessToken (23 words) - [core.createbinaryoptions.contenttype | Medplum](/content/docs/sdk/core-createbinaryoptions-contenttype.html): Home > @medplum/core > CreateBinaryOptions > contentType (13 words) - [Disaster Recovery | Medplum](/content/docs/self-hosting/disaster-recovery/index.html): This document outlines a high-level approach to disaster recovery for a self-hosted Medplum instance deployed across various infrastructure options, including cloud providers (AWS, GCP, Azure) and Kubernetes. It is intended as a foundational overview to facilitate discussions and planning, rather than a detailed step-by-step runbook. (900 words) - [2 docs tagged with "ai" | Medplum](/content/docs/tags/ai/index.html) (75 words) - [core.mockasyncclientstorage._constructor_ | Medplum](/content/docs/sdk/core-mockasyncclientstorage-_constructor_.html): Home > @medplum/core > MockAsyncClientStorage > (constructor) (11 words) - [Medplum Version Policy | Medplum](/content/docs/compliance/versions/index.html): Overview (799 words) - [One doc tagged with "attachments" | Medplum](/content/docs/tags/attachments/index.html) (16 words) - [Search the documentation | Medplum](/content/search/index.html) (372 words) - [3 docs tagged with "compliance" | Medplum](/content/docs/tags/compliance/index.html) (135 words) - [SimpleQuantity | Medplum](/content/docs/api/fhir/datatypes/simplequantity/index.html): A fixed quantity (no comparator) (284 words) - [Analytics | Medplum](/content/docs/analytics/index.html): When designing a healthcare analytics program, data quality and integrity are critical. To create a robust analytics program, constant monitoring of data quality and can be enabled and will be required to ensure that reports are meaningful and accurate. (1,129 words) - [core.internaltypeschema.description | Medplum](/content/docs/sdk/core-internaltypeschema-description.html): Home > @medplum/core > InternalTypeSchema > description (7 words) - [15 posts tagged with "compliance" | Medplum](/content/blog/tags/compliance/page/2/index.html) (153 words) - [core.isconflict | Medplum](/content/docs/sdk/core-isconflict.html): Home > @medplum/core > isConflict (17 words) - [One post tagged with "lifesciences" | Medplum](/content/blog/tags/lifesciences/index.html) (35 words) - [core.medplumsourceinfraconfig.appdomainname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-appdomainname.html): Home > @medplum/core > MedplumSourceInfraConfig > appDomainName (7 words) - [UsageContext | Medplum](/content/docs/api/fhir/datatypes/usagecontext/index.html): Base StructureDefinition for UsageContext Type: Specifies clinical/business/etc. metadata that can be used to retrieve, index and/or categorize an artifact. This metadata can either be specific to the applicable population (e.g., age category, DRG) or the specific context of care (e.g., venue, care setting, provider of care). (267 words) - [core.constraint.description | Medplum](/content/docs/sdk/core-constraint-description.html): Home > @medplum/core > Constraint > description (5 words) - [Range | Medplum](/content/docs/api/fhir/datatypes/range/index.html): Base StructureDefinition for Range Type: A set of ordered Quantities defined by a low and high limit. (224 words) - [One post tagged with "release" | Medplum](/content/blog/tags/release/index.html) (70 words) - [core.satisfiedaccesspolicy | Medplum](/content/docs/sdk/core-satisfiedaccesspolicy.html): Home > @medplum/core > satisfiedAccessPolicy (95 words) - [IP Access Rules | Medplum](/content/docs/access/ip-access-rules/index.html): One valuable way to prevent unauthorized data access is to restrict access to clinical data by the user's IP address. This article will discuss the benefits of IP address restrictions and provide a step-by-step guide on configuring these settings in Medplum's AccessPolicy. (283 words) - [Running the Medplum Docker Container | Medplum](/content/docs/self-hosting/running-medplum-docker-container/index.html): Medplum provides a Docker image, called medplum/medplum-server. This image is mainly used to install Medplum on AWS, however it can also be run independently of AWS. (161 words) - [Monitoring Bots | Medplum](/content/docs/bots/monitoring-bots/index.html): Bots allow for powerful functionality in your app, so it is very important to track what exactly each bot has done. This is possible using a bot's AuditEvent resources, which track: (474 words) - [Blog | Medplum](/content/blog/page/6/index.html): Blog (157 words) - [Interoperability | Medplum](/content/solutions/interoperability/index.html): HL7 Connectivity (136 words) - [One doc tagged with "e-signature" | Medplum](/content/docs/tags/e-signature/index.html) (54 words) - [core.pointerevaluation.key | Medplum](/content/docs/sdk/core-pointerevaluation-key.html): Home > @medplum/core > PointerEvaluation > key (8 words) - [Branding and Customization | Medplum](/content/docs/self-hosting/branding/index.html): When building an EHR, you often want to change the logo and name of your platform for clarity or branding. In Medplum, this is simple: (261 words) - [Medplum EHR | Medplum](/content/solutions/medplum-ehr/index.html): A streamlined EHR that's easy to implement and supports core workflows. Chart efficiently, place orders and schedule with ease. Medplum EHR features the following features. (138 words) - [Resource $validate | Medplum](/content/docs/api/fhir/operations/validate-a-resource/index.html): The $validate operation checks whether a FHIR resource conforms to the base specification and any applicable profiles without actually creating or updating it. This is essential for catching data quality issues early, providing real-time feedback in forms, and testing integrations before committing data to the system. (403 words) - [core.medplumclientoptions.storageprefix | Medplum](/content/docs/sdk/core-medplumclientoptions-storageprefix.html): Home > @medplum/core > MedplumClientOptions > storagePrefix (33 words) - [Open Patient Registration | Medplum](/content/docs/user-management/open-patient-registration/index.html): Introduction (138 words) - [core.valid_hostname_regex | Medplum](/content/docs/sdk/core-valid_hostname_regex.html): Home > @medplum/core > VALID\HOSTNAME\REGEX (8 words) - [core.ilogger.error | Medplum](/content/docs/sdk/core-ilogger-error.html): Home > @medplum/core > ILogger > error (28 words) - [Authorization and Access Control | Medplum](/content/docs/access/index.html): The Access Control Decision Guide walks through requirements questions and FHIR modeling decisions for access control — use it alongside these docs. (125 words) - [One doc tagged with "self-host" | Medplum](/content/docs/tags/self-host/index.html) (307 words) - [Quantity | Medplum](/content/docs/api/fhir/datatypes/quantity/index.html): Base StructureDefinition for Quantity Type: A measured amount (or an amount that can potentially be measured). Note that measured amounts include amounts that are not precisely quantified, including amounts involving arbitrary units and floating currencies. (298 words) - [core.humannameformatoptions | Medplum](/content/docs/sdk/core-humannameformatoptions.html): Home > @medplum/core > HumanNameFormatOptions (26 words) - [core.indexconceptmapcodings | Medplum](/content/docs/sdk/core-indexconceptmapcodings.html): Home > @medplum/core > indexConceptMapCodings (22 words) - [core.fhircastreportreferencecontext | Medplum](/content/docs/sdk/core-fhircastreportreferencecontext.html): Home > @medplum/core > FhircastReportReferenceContext (15 words) - [Contributor | Medplum](/content/docs/api/fhir/datatypes/contributor/index.html): Base StructureDefinition for Contributor Type: A contributor to the content of a knowledge asset, including authors, editors, reviewers, and endorsers. (226 words) - [core.medplumsourceinfraconfig.storagedomainname | Medplum](/content/docs/sdk/core-medplumsourceinfraconfig-storagedomainname.html): Home > @medplum/core > MedplumSourceInfraConfig > storageDomainName (7 words) - [core.conceptmaptranslateoutput.match | Medplum](/content/docs/sdk/core-conceptmaptranslateoutput-match.html): Home > @medplum/core > ConceptMapTranslateOutput > match (8 words) - [core.internaltypeschema.kind | Medplum](/content/docs/sdk/core-internaltypeschema-kind.html): Home > @medplum/core > InternalTypeSchema > kind (8 words) - [2 posts tagged with "fhir" | Medplum](/content/blog/tags/fhir/index.html) (135 words) - [3 docs tagged with "lab" | Medplum](/content/docs/tags/lab/index.html) (121 words) - [5 docs tagged with "diagnostics" | Medplum](/content/docs/tags/diagnostics/index.html) (212 words) - [One doc tagged with "Encounter" | Medplum](/content/docs/tags/encounter/index.html) (36 words) - [One doc tagged with "ServiceRequest" | Medplum](/content/docs/tags/service-request/index.html) (41 words) - [core.readablepromise._constructor_ | Medplum](/content/docs/sdk/core-readablepromise-_constructor_.html): Home > @medplum/core > ReadablePromise > (constructor) (20 words) - [One doc tagged with "patient" | Medplum](/content/docs/tags/patient/index.html) (62 words) - [One doc tagged with "app" | Medplum](/content/docs/tags/app/index.html) (46 words) - [core.ireconnectingwebsocket.readystate | Medplum](/content/docs/sdk/core-ireconnectingwebsocket-readystate.html): Home > @medplum/core > IReconnectingWebSocket > readyState (8 words) - [One post tagged with "careplan" | Medplum](/content/blog/tags/careplan/index.html) (26 words) - [core.smarthealthlinkpayload.label | Medplum](/content/docs/sdk/core-smarthealthlinkpayload-label.html): Home > @medplum/core > SmartHealthLinkPayload > label (7 words) - [core.voidablediff | Medplum](/content/docs/sdk/core-voidablediff.html): Home > @medplum/core > VoidableDiff (45 words) - [core.infixoperatoratom.left | Medplum](/content/docs/sdk/core-infixoperatoratom-left.html): Home > @medplum/core > InfixOperatorAtom > left (9 words) - [core.inviterequest.email | Medplum](/content/docs/sdk/core-inviterequest-email.html): Home > @medplum/core > InviteRequest > email (13 words) - [One doc tagged with "Observation" | Medplum](/content/docs/tags/observation/index.html) (49 words) - [5 docs tagged with "care plans" | Medplum](/content/docs/tags/care-plans/index.html) (213 words) - [Medical Imaging in Medplum - DICOM & DICOMweb Beta | Medplum](/content/blog/dicom-beta/index.html): Medical imaging has been the part of the patient record that lives somewhere else. A digital health (1,098 words, Aug 7, 2026) - [Profile Health: Genetic Intelligence for Longevity Medicine | Medplum](/content/blog/profile-case-study/index.html): {/* (1,189 words, Aug 3, 2026) - [YC x Medplum Hackathon | Medplum](/content/blog/yc-medplum-hackathon-2026/index.html): Today is the day: Medplum is hosting the Agentic Healthcare Hackathon with Y Combinator at the YC office in San Francisco on Saturday, August 1, 2026. (527 words, Aug 1, 2026) - [Preparing for 2027 Prior Auth Regulatory Requirements | Medplum](/content/blog/fhirplace-participant-2026/index.html): Prior authorization is one of the biggest sources of administrative burden in healthcare, and it is now the subject of a regulatory deadline. CMS-0057-F and HTI-4 require payers and providers to support electronic prior authorization workflows built on FHIR, with enforcement beginning January 2027. (249 words, Jul 24, 2026) - [Everself: Enhanced Obesity Care | Medplum](/content/blog/everself-case-study/index.html): Everself is building the second line of defense for obesity care. Every month, more than a million patients drop off GLP-1 medications, and most regain the weight within three to six months. Until now, the only durable alternative has been invasive bariatric surgery, which can require weeks away from work. Everself fills the gap with an outpatient endoscopic weight loss procedure that delivers bariatric-level results without surgery, wrapped in a longitudinal care program delivered by a full care team. (665 words, Jul 17, 2026) - [Forward Deployed Engineering, Medplum-Style | Medplum](/content/blog/fde/index.html): You have probably noticed that "Forward Deployed Engineer" is having a moment. Over the last couple of years the role has spread from (1,656 words, Jul 1, 2026) - [Medplum Monthly Update - June 2026 | Medplum](/content/blog/june-2026-update/index.html): The headline this month: Medplum achieved HITRUST certification, a validation of our security and compliance program. June was also another busy month of shipping, with 200+ commits from 25+ contributors and nine patch releases — v5.1.14 through v5.1.22. (1,395 words, Jul 1, 2026) - [Medplum Scheduling API - Beta Release | Medplum](/content/blog/scheduling-beta/index.html): After several months of preview as an Alpha product, we are pleased to announce that Medplum's Scheduling API has graduated to Beta. (415 words, Jun 25, 2026) - [From BLE to FHIR: Streaming Clinical-Grade Biosignals with AnyBio + Medplum | Medplum](/content/blog/ble-to-fhir-anybio-medplum/index.html): If you're building a digital health product, you've probably hit the same wall everyone hits: the gap between a wearable's raw signal and a clinical-grade artifact in the EHR that is actionable by a clinician. (1,926 words, Jun 22, 2026) - [Large Patient Charts | Medplum](/content/blog/large-patient-charts/index.html): There's a piece of conventional wisdom in health tech that won't die: FHIR is fine for interoperability, but too slow and bloated for real-time clinical apps. (484 words, Jun 21, 2026) - [Vibe Coding on Medplum | Medplum](/content/blog/building-on-medplum-with-ai/index.html): More and more Medplum users are building with AI coding assistants — Cursor, Claude, Copilot, and others. We have been talking to users about what works and wrote up what we have learned in a new guide: Building on Medplum with AI Coding Assistants. This post is the short version of what is in there. (895 words, Jun 8, 2026) - [Medplum Achieves HITRUST e1 Certification | Medplum](/content/blog/hitrust-e1-certification/index.html): Demonstrating commitment to cybersecurity and information protection: HITRUST Certification validates the Medplum Platform is meeting rigorous cybersecurity and data protection standards through independent assessment and assurance. (359 words, Jun 1, 2026) - [Medplum Monthly Update - May 2026 | Medplum](/content/blog/may-2026-update/index.html): May was a heavy month for Medplum, with 100+ commits from 20+ contributors and four patch releases — v5.1.10 through v5.1.13. Scheduling was the headline: the full appointment operation suite — $find, $hold, $book, $confirm, and $cancel — landed in Alpha. The Provider App also gained medication ordering components, order set import, and operation-based claim submission. On the enterprise side, a new data warehouse export features were enabled, and the platform team shipped passwordless magic-link login, AWS GuardDuty malware protection, and a round of OAuth2 spec-compliance fixes. All of this continues to drive forward our 2026 roadmap priorities. (1,525 words, Jun 1, 2026) - [PlumCon 2026 - Agenda | Medplum](/content/blog/plumcon-2026/index.html): - Register here for PlumCon 2026, September 3, 2026 in San Francisco (584 words, May 8, 2026) - [Medplum Monthly Update - April 2026 | Medplum](/content/blog/april-2026-update/index.html): Medplum stayed active this April, with 130+ commits from 20+ contributors amounting to three patch releases — v5.1.7, v5.1.8, and v5.1.9. The Provider app's billing and coverage workflows took a major step forward with integrated claim submission and live eligibility visibility. Scheduling added support for service line configurations on HealthcareService, aligning with R5/R6 FHIR conventions. Spaces, an AI-powered chat workspace inside the Provider App, now surfaces tool calls and responses directly in the chat so you can see exactly what the AI is doing. Clinical documentation expanded across intake, care plans, diagnostics, authentication, and integrations. All of this continues to drive forward our 2026 roadmap priorities. (1,468 words, May 1, 2026) - [Medplum Monthly Update - March 2026 | Medplum](/content/blog/march-2026-update/index.html): March was yet another busy month for Medplum. Three patch releases — v5.1.2, v5.1.3, and v5.1.4 — arrived alongside over 100 commits from 20+ contributors, and the work underneath the surface was just as significant as the new features. Spaces gained richer AI tooling. The communications documentation received a full suite of guides covering everything from the data model to automations. Worker infrastructure got a substantial rethink, and WebSocket subscriptions were hardened across the board. All of it continues to advance our 2026 roadmap priorities. (1,189 words, Apr 1, 2026) - [Medplum Self-Hosted Performance Benchmarks | Medplum](/content/blog/medplum-performance-test-2026/index.html): One of the most common questions we hear from teams evaluating Medplum is: "Can it handle our scale?" We wanted to answer that question with real data. We recently ran a formal performance evaluation against a self-hosted Medplum deployment that mirrors one of our largest production clusters, and the results speak for themselves - peak throughput exceeding 46,000 requests per second for read-only traffic and nearly 7,000 requests per second for full read/write/search FHIR workflows, with zero HTTP failures across all scenarios. (629 words, Mar 30, 2026) - [Medplum Monthly Update - February 2026 | Medplum](/content/blog/february-2026-update/index.html): February was a productive month for Medplum. We shipped four releases — v5.0.14, v5.0.15, v5.1.0, and v5.1.1, including a minor version bump reflecting the depth of new capabilities — with over 130 commits from 25+ contributors. The biggest themes this month were WebSocket subscription stability and performance improvements, AI-powered provider experiences, scheduling refinements, and revenue cycle tooling — all advancing our 2026 roadmap priorities. (1,569 words, Mar 1, 2026) - [Identity Management - A Practical Guide | Medplum](/content/blog/identity-management/index.html): Healthcare applications require careful decisions about user authentication and access control. Whether you're building an EHR, a clinical workflow tool, or a patient portal, getting identity management right from the start will save you from costly architectural mistakes down the road. (1,530 words, Feb 4, 2026) - [Medplum Monthly Update - January 2026 | Medplum](/content/blog/january-2026-update/index.html): January was a packed month for Medplum. We shipped three patch releases (v5.0.11, v5.0.12, v5.0.13), published the 2026 Roadmap, and landed over 100 commits from 20+ contributors. The biggest themes this month were scheduling, the Provider app, and site reliability — all directly advancing our 2026 roadmap priorities. (1,004 words, Feb 1, 2026) - [Medplum 2026 Roadmap | Medplum](/content/blog/2026-roadmap/index.html): As we kick off 2026, we're excited to share Medplum's vision for the year ahead. Our open-source healthcare development platform has experienced substantial growth throughout 2025: (506 words, Jan 3, 2026) - [Medplum Year in Review 2025 | Medplum](/content/blog/2025-year-in-review-medplum/index.html): 2025 in Review (307 words, Dec 31, 2025) - [Terminology Service Updates in Medplum v5 | Medplum](/content/blog/v5-terminology/index.html): As part of the Medplum v5 release, we've been hard at work delivering several key improvements to our (1,482 words, Nov 6, 2025) - [Scheduling Agents for Healthcare Operations: A Deep Dive with Unity AI | Medplum](/content/blog/scheduling-agents-unity-ai/index.html): Slideshow: View Presentation (809 words, Nov 1, 2025) - [Medplum v5 is Released | Medplum](/content/blog/v5-release/index.html): We are pleased to announce the Release of Medplum v5, the next major version of the open source healthcare developer platform. (764 words, Oct 27, 2025) - [HealthChain: A New Open Source Integration with Epic | Medplum](/content/blog/healthchain/index.html): We're excited to share a new open-source project from the community that addresses a common developer challenge: integrating with legacy healthcare systems. HealthChain, an open-source Python framework, makes it easier to connect AI/ML pipelines to healthcare systems. (201 words, Sep 29, 2025) - [FHIR + AI for Life Sciences | Medplum](/content/blog/fhir-ai-for-life-sciences/index.html): Hello everyone, (173 words, Sep 23, 2025) - [Medplum Events Calendar | Medplum](/content/blog/events-calendar/index.html): Upcoming (288 words, Sep 22, 2025) - [Our Journey with the OpenSSF | Medplum](/content/blog/openssf/index.html): At Medplum, our mission is to provide the open source developer platform for healthcare. We believe that open source is the best way to build secure and interoperable healthcare applications. However, with the rising concern over software supply chain attacks, we understand that being "open source" isn't enough; we need to actively prove our commitment to security. (535 words, Sep 22, 2025) - [PlumCon 2025 - Materials & Agenda | Medplum](/content/blog/plumcon-2025-materials/index.html): On August 28, 2025 Medplum hosted our first annual developer conference PlumCon in San Francisco. Thank you to everyone who attended and made this inaugural event such a success! (440 words, Sep 5, 2025) - [Medplum Certifies IRA | Medplum](/content/blog/ihe-ira-radiology-reporting/index.html): Medplum has become one of the first platforms to achieve certification for the Hub role in the Integrated Reporting Applications (IRA) IHE Profile, marking a milestone in radiology workflow interoperability. This certification positions Medplum as a central orchestrator for real-time synchronization between radiology applications, addressing one of healthcare's most persistent challenges: fragmented diagnostic workflows. (1,196 words, Jul 12, 2025) - [PlumCon 2025 - Agenda | Medplum](/content/blog/plumcon-2025/index.html): On August 28, 2025 Medplum is hosting our first annual developer conference PlumCon in San Francisco. The conference is by invitation, but please email us at hello@medplum.com if you are interested. Here is the agenda. (139 words, Jul 5, 2025) - [Medplum Supports Custom FHIR Operations | Medplum](/content/blog/custom-fhir-operations/index.html): Healthcare APIs need flexibility. While FHIR's standard CRUD operations (create, read, update, delete) handle most use cases, real-world healthcare workflows often require custom logic that goes beyond basic data manipulation. That's why we're excited to introduce custom FHIR operations in Medplum. (517 words, Jul 3, 2025) - [Medplum Support for Anthropic's Model Context Protocol (MCP) | Medplum](/content/blog/unlocking-healthcare-ai-medplum-support-mcp/index.html): Medplum is the platform of choice for technical leaders in healthcare, and that has given us a unique perspective into the transformative power of AI in healthcare - we get asked about it every single day. (1,090 words, Jun 20, 2025) - [Our Guide to Security Reports | Medplum](/content/blog/security-reports/index.html): As a founder, you wear a lot of hats. One of mine is handling the security reports that land in our inbox. (399 words, Jun 9, 2025) - [EHRs, UDHPs, and Health Tech's Next Phase | Medplum](/content/blog/ehr-vs-udhp/index.html): Healthcare technology relies on established systems like Electronic Health Records (EHRs) and is now incorporating concepts like Unified Digital Health Platforms (UDHPs). Understanding this evolution is key to navigating the industry's direction. (387 words, May 30, 2025) - [So You’re Thinking About Forking | Medplum](/content/blog/so-youre-thinking-about-forking/index.html): Forking can look like the fastest path to control, but it often becomes a long‑term maintenance tax. Here’s a pragmatic checklist to decide—and alternatives that usually win. (674 words, May 15, 2025) - [Preparing for Medplum v5 | Medplum](/content/blog/preparing-for-v5/index.html): As the open source healthcare developer platform of choice for innovators worldwide, Medplum continues to evolve with the rapidly changing technology landscape. We're excited to announce our upcoming major version release, Medplum v5, scheduled for October 2025. This post outlines the significant changes coming in this release to help our users prepare accordingly. (533 words, May 12, 2025) - [Multi-Tenant MSO with Medplum | Medplum](/content/blog/multi-tenant-mso/index.html): In the Medplum community of implementors, a common use case is building an application that serves multiple clinics in the form of a Managed Service Organization (MSO). An MSO is a separate business entity that provides non-clinical services—e.g., revenue-cycle management, HR, IT, compliance, facilities, and purchasing—to physician groups or other provider organizations. (1,121 words, Apr 22, 2025) - [Technical Guide to TEFCA | Medplum](/content/blog/technical-guide-to-tefca/index.html): Andrei Zudin is a healthcare interoperability expert and advisor to the Medplum community. He is the former CTO and co-founder of Health Gorilla. (5,117 words, Mar 27, 2025) - [Medplum for Mirth Users | Medplum](/content/blog/medplum-for-mirth-users/index.html): Modern Healthcare Integration in the Wake of NextGen's Announcement (575 words, Mar 23, 2025) - [Medplum v4.0.0 Upgrade Notice | Medplum](/content/blog/v4-upgrade/index.html): We've heard many success stories from enthusiastic early adopters who have smoothly upgraded to v4. Thank you all for your support and your feedback in this process! (628 words, Feb 28, 2025) - [Medplum v4.0.0 Release | Medplum](/content/blog/v4/index.html): Medplum v4.0.0 is coming soon! Many of the new features in this release have already been rolled out incrementally, making the v4.0.0 designation more symbolic of the semantic versioning. We prioritize stability and backwards compatibility and work hard to minimize unnecessary changes. However, sometimes changes are necessary to keep the platform up-to-date and secure. This document outlines the key updates in v4.0.0, including important information for self-hosting deployments and TypeScript SDK users. (682 words, Feb 20, 2025) - [Devtools for Life Sciences | Medplum](/content/blog/life-sciences-devtools/index.html): On January 15, 2025 Medplum & Flexpa held a JPMorgan companion event for the community. During the event, there were demos of many different open source tools that aid in development for life science workflows. (411 words, Feb 7, 2025) - [Talks & Podcasts with the Medplum Team | Medplum](/content/blog/podcast-appearances/index.html): On occasion, the Medplum team gives talks about our community, product and philosophy. You can find them here: (254 words, Feb 1, 2025) - [Medplum 2025 Roadmap | Medplum](/content/blog/2025-roadmap/index.html): As we kick off 2025, we're excited to share Medplum's vision for the year ahead. Our open-source healthcare development platform has seen extraordinary growth, with our community of builders and innovators expanding rapidly throughout 2024: (363 words, Jan 8, 2025) - [Medplum Year in Review 2024 | Medplum](/content/blog/2024-year-in-review-medplum/index.html): 2024 in Review (162 words, Dec 31, 2024) - [FHIR Workflow Patterns to Simplify Your Life | Medplum](/content/blog/fhir-workflow-patterns-to-simplify-your-life/index.html): If you've worked with FHIR before, you've probably noticed there are a lot of resources. And I mean a lot! At first glance, it might seem overwhelming to figure out how they all fit together. But here's the thing: once you understand a few core patterns, the whole system starts to make much more sense. (1,389 words, Dec 28, 2024) - [Achieving a zero-downtime Postgres major version upgrade | Medplum](/content/blog/zero-downtime-postgres-major-version-upgrade/index.html): Medplum is built on Postgres. Until recently, our hosted Medplum service was using an Amazon Web Services (AWS) RDS Aurora Postgres cluster running version 12.16. Since v12 is rather outdated and nearing the end of its standard support window on RDS, it was time to plan our upgrade to the newest version available on RDS, v16.4. Various methods to upgrade to a new major version on various places across the downtime vs level-of-effort continuum; we decided to upgrade our database with no downtime. This is how we did it. (2,540 words, Nov 14, 2024) - [Awell - clinical workflow automation on Medplum | Medplum](/content/blog/awell-health-medplum/index.html): Awell is a low-code platform designed to enable your clinical teams to design, operate and continuously improve your care flows with minimal engineering lift. (404 words, Jul 16, 2024) - [Supporting Stanford Biodesign OpenCareHub | Medplum](/content/blog/stanford-biodesign-opencarehub/index.html): Medplum is a community, and advocacy for standards and open source implementations are core to our mission. I’m writing today to share Medplum’s support for Stanford Biodesign OpenCareHub’s proposal for ARPA-H PARADIGM. (132 words, May 2, 2024) - [Chamber Cardio - case study | Medplum](/content/blog/chamber-cardio-case-study/index.html): Chamber Cardio, a technology-enabled cardiology solution, helps enable and empower cardiologists and practices in their transition to value-based care. With our cloud-based technology platform, we offer a suite of tools designed specifically for cardiovascular care. These tools provide real-time insights, analytics and care coordination tools focused on improving outcomes for patients with chronic cardiovascular conditions. (1,006 words, Mar 27, 2024) - [Flexpa - sync health history to apps | Medplum](/content/blog/flexpa-case-study/index.html): Claims data is a uniquely rich source of financial and clinical data important to many healthcare workflows. The EDI 837 Health Care Claim transaction is one of the oldest forms of electronic data exchange, stemming from being defined as a required data transmission specification by HIPAA. (387 words, Feb 22, 2024) - [Develo Pediatric EHR | Medplum](/content/blog/develo-case-study/index.html): Develo has built a full-featured EHR and customer relationship management (CRM) for pediatrics, encompassing core scheduling, clinical, and billing workflows along with family engagement capabilities. (201 words, Jan 26, 2024) - [Medplum Year in Review 2023 | Medplum](/content/blog/2023-year-in-review-medplum/index.html): 2023 in Review (149 words, Dec 31, 2023) - [Rad AI Omni Reporting - Case Study | Medplum](/content/blog/radai-case-study/index.html): Medplum’s Open-Source FHIRcast Hub Enables Rad AI Omni Reporting's Interactive Measurements (493 words, Dec 18, 2023) - [Digital Health is an Operations Game | Medplum](/content/blog/digital-health-operations/index.html): Digital health companies are at the forefront of revolutionizing patient experience by combining quality care, at lower costs, and at national scale. Typically, they target a specific healthcare niche, concentrating on top-notch execution. Their ultimate goal? To merge an exceptional patient experience with smooth operations behind the scenes. (1,051 words, Oct 27, 2023) - [AI Driven Patient Intake and EMPI - Titan Case Study | Medplum](/content/blog/titan-case-study/index.html): Those who have experienced the wait and shuffle of a specialist referral will appreciate the thoughtful and futuristic approach of the team at Titan Intake. (469 words, Sep 10, 2023) - [GraphQL vs REST APIs | Medplum](/content/blog/graphql-vs-rest/index.html): One of the most frequent questions we get from our users is whether they should use Medplum's REST or GraphQL APIs. Both have a FHIR specification, but they offer different tradeoffs for different use cases. (1,083 words, Sep 6, 2023) - [Congrats YC S23 Healthcare | Medplum](/content/blog/yc-s23-healthcare/index.html): As a long time YC community member (10+ years) and former Visiting Group Partner, I'm always excited by the great companies that release each Demo Day. For me, it's like the Superbowl 🏈. (987 words, Sep 3, 2023) - [EMPI Reference Implementation | Medplum](/content/blog/empi-implementation/index.html): Patient record-keeping systems often have duplicate patient records, which can affect patient care and service delivery. One of the Medplum use cases is the the Enterprise Mater Patient Index (EMPI), database used in healthcare settings to maintain accurate and consistent unique identifiers for patients across various departments and services. A great EMPI implementation will improve patient safety, enhance the quality of care, facilitate data sharing among disparate healthcare systems, AND speed payer contracting. (1,728 words, Aug 30, 2023) - [YC Open Source Founders - Q&A | Medplum](/content/blog/yc-oss-faq/index.html): YC invites alumni (like us - Medplum is YC S22) to come speak for the current batch and share our experiences. We were excited when our YC Partners Diana and Nicolas invited Medplum to come and speak to Open Source and devtools companies two weeks ago. (1,146 words, Aug 17, 2023) - [ONC Certified for (b)(10) | Medplum](/content/blog/onc-b10-certification-medplum/index.html): The Medplum team is pleased to announce that we have certified the (b)(10) ONC Criteria - Electronic Health Information Export. (229 words, Aug 15, 2023) - [Demystifying FHIR Systems | Medplum](/content/blog/demystifying-fhir-systems/index.html): One of the main sources of confusion when starting an implementation is with FHIR system strings. (763 words, Aug 8, 2023) - [Vanya for Browsing Data on Medplum's FHIR Server | Medplum](/content/blog/vanya-and-medplum/index.html): Darren Devitt, a respected FHIR expert, has recently released an alpha version of a new tool called Vanya. Similar to how Postman functions for API requests, Vanya is designed specifically for browsing data on FHIR servers. (274 words, Aug 4, 2023) - [Medplum's Proposal for NASA's Health Tech RFP | Medplum](/content/blog/medplum-for-nasa-and-trish/index.html): NASA's TRISH team (Translational Research Institute for Space Health) recently issued an RFP for a healthcare tech platform designed for monitoring spaceflight participant health metrics during space missions. TRISH is a virtual consortium focused on applied research to ensure astronaut health during space exploration. (308 words, Aug 1, 2023) - [24/7 Pediatrician Access - Summer Health Case Study | Medplum](/content/blog/summer-case-study/index.html): Summer Health is an innovator in direct-to-patient pediatrics, with a focus on messaging and mobile access for parents via SMS. Their fast growing practice is available nationwide and is known for excellent patient engagement. (419 words, Jul 18, 2023) - [Value Based Care and Elderly Populations - Ensage Case Study | Medplum](/content/blog/ensage-case-study/index.html): (2 minute demo) (561 words, Jun 19, 2023) - [At Home Diagnostics - Ro Case Study | Medplum](/content/blog/ro-case-study/index.html): {/ truncate /} (99 words, Jun 15, 2023) - [Power of g10 - Codex Case Study | Medplum](/content/blog/codex-and-the-power-of-g10/index.html): Codex Health enables health systems manage their patient populations with effective remote patient monitoring (RPM) programs for diabetes, cardiovascular diseases and more. (1,627 words, May 8, 2023) - [Medplum Talk at MITRE OHS | Medplum](/content/blog/medplum-mitre-talk/index.html): MITRE Open Health Solutions is a leader in healthcare open source and are the makers of Inferno, Synthea and more - which are tools we use all the time here. (748 words, Apr 14, 2023) - [Medplum at HIMSS 2023 | Medplum](/content/blog/medplum-at-himss-2023/index.html): Medplum will be at HIMSS on April 17-19, 2023 participating in the HIMSS23 Cancer Care: Treating the Whole Person Demonstration hosted by the CDC in McCormick Place, North Building Hall B, Booth 7649. (110 words, Apr 10, 2023) - [Dependency Warnings | Medplum](/content/blog/dependency-warnings/index.html): Today, we received a thoughtful email from an engineering leader who installed Medplum for the first time: (422 words, Apr 7, 2023) - [Post-Installation Steps to Verify Your Environment | Medplum](/content/blog/post-install-verification/index.html): This guide is for customers who are self-hosting Medplum, and this post assumes that your installation was complete and successful. We will refer to your base installation as $domainName, and this refers to the domain on which the Medplum app is running, for example on hosted Medplum the domain is app.medplum.com. (757 words, Apr 4, 2023) - [FHIR R5 | Medplum](/content/blog/fhir-r5/index.html): In January 2024, the United States Regulators Steering Committee (USRSC) made a significant decision regarding the future of FHIR implementation in the U.S. They announced that the next version of US Core will be based on FHIR R6, effectively signaling a strategic move to bypass R5. (360 words, Mar 27, 2023) - [Patient Deduplication | Medplum](/content/blog/patient-deduplication/index.html): Patient deduplication is a tough problem, and there are many approaches to implementing a deduplication program. We provide this guide and sample code as a resource to teams who want to run a continuous deduplication program that is powered by automation and highly auditable. (349 words, Mar 8, 2023) - [Task Management Apps | Medplum](/content/blog/task-management-apps/index.html): Great workflow apps are core for us at Medplum, and we provide tools to build highly ergonomic asynchronous task tracking systems providers. Some examples of task management apps in the medical context are apps that: (542 words, Mar 6, 2023) - [We're hiring | Medplum](/content/blog/we-are-hiring/index.html): We're hiring! Check out the new Careers page. (74 words, Jan 23, 2023) - [Medplum Year in Review 2022 | Medplum](/content/blog/2022-year-in-review-medplum/index.html): 2022 in Review (220 words, Dec 26, 2022) - [Composability, Open Source, Standards, API-First | Medplum](/content/blog/composability-medplum/index.html): Composability venn diagram (781 words, Dec 8, 2022) - [What is ONC Certification? | Medplum](/content/blog/what-is-onc-certification/index.html): What is ONC Certification? (569 words, Dec 6, 2022) - [Medplum is a YC Company! | Medplum](/content/blog/medplum-in-yc/index.html): Medplum is a YC Company (182 words, Aug 2, 2022) - [Extending Objects through FHIR Extensions | Medplum](/content/blog/fhir-extensions-intro/index.html): When working with customers to set up their apps and workflow we commonly get this request: (422 words, Feb 12, 2022) - [SOC2 for Medplum | Medplum](/content/blog/soc2-type1/index.html): We at Medplum are pleased to share the news that we have recently completed our System and Organization Controls (SOC) 2 Type I audit. (282 words, Feb 11, 2022) - [Understanding FHIR Questionnaires | Medplum](/content/blog/understanding-fhir-questionnaires/index.html): At Medplum we know that customizable forms are critical for any healthcare app. Is it even a healthcare app without tons of forms? (390 words, Dec 23, 2021) - [Getting Started with Synthetic FHIR Data | Medplum](/content/blog/2021/12/13/synthea/index.html): Synthetic FHIR data is increasingly popular for people who are building healthcare apps. It's useful for testing, prototyping, partnerships, sales and more. In the implementations we see here at Medplum, more than half use synthetic data in some form or another! (293 words, Dec 13, 2021) - [Learning FHIR Quickly | Medplum](/content/blog/2021/12/06/learning-fhir-quickly/index.html): You can use Medplum as a tool to help you learn FHIR quickly. (256 words, Dec 6, 2021) - [Introducing Medplum | Medplum](/content/blog/2021/11/04/introducing-medplum/index.html): Developer infrastructure and tools for healthcare apps (234 words, Nov 4, 2021) ## About Pages - [Contact Us | Medplum](/content/contact/index.html): Need Support? (71 words) - [About us | Medplum](/content/about/index.html) (360 words) ## Resources - [Full Page Index](/index.html): Browse all cached pages with rich metadata - [About This Cache](/about.html): Methodology, technical details, and usage guidelines - [XML Sitemap](/sitemap.xml): Machine-readable sitemap for crawler discovery - [Robots.txt](/robots.txt): Crawler directives - [AgentSite Network](https://agentsite.network/network.html): Public index of AgentSites and their machine-readable resources